O-Antigen Description

Serogroup:O143
Serotype H:
Serotype K:
Strain:
Structure:
Gro(2-N-6)
        |
 ->2)bDGalA(1->3)aDGalNAc(1->4)bDGlcA(1->3)bDGlcNAc(1->
Comment:- Structure [1]
- bDGalA has 0.3 acetyl groups/repeating unit at position 3
- bDGalA has 0.5 acetyl groups/repeating unit at position 4
- Similar to the yet untyped L-19[4]
->3)bDGlcA(GroN)(1->4)bDGlc(1->4)bDGalA(1->3)bDGlcNAc(1->
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdR

GT NameDonorAcceptorScore / e-value
O167-WfdG

bDGalA6NLAla(1->

->3)aDGlcNAc

155 / 3e-46
O46-O046_03


97 / 5e-25
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdT

GT NameDonorAcceptorScore / e-value
O167-WfdH


92 / 2e-23
O37-O037_11


85 / 9e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdU
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdV

bDGlcA(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O38-O038_09


301 / 6e-104
O140-O140_14


286 / 9e-98
O112-WfeI


243 / 6e-81
O30-O030_06


207 / 5e-67
O93-O093_02


195 / 2e-62
O91-WbsA


191 / 9e-61
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

182 / 3e-57
O134-O134_08


180 / 1e-56
O46-O046_08


179 / 2e-56
O157-WbdN


178 / 7e-56
O24-WfaM

bDGlc(1->

->3)bDGalNAc

178 / 1e-55
O79-WbdX


176 / 8e-55
O182-O182_10


175 / 1e-54
O61-WeiL


174 / 3e-54
O130-WffJ


173 / 6e-54
O27-WejU


173 / 4e-54
O21-WclQ


167 / 2e-51
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

167 / 8e-52
O81-O081_11


166 / 6e-51
O82-O082_09


160 / 5e-49
O165-WcnW


160 / 5e-49
O102-WelO

bDGlc(1->

->3)bDGalNAc

159 / 1e-48
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

138 / 2e-40
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

134 / 8e-39
O32-WfeA


100 / 5e-26
O169-O169_03


91 / 7e-23
O128-WbsK

bDGalNAc(1->

->4)aDGal

89 / 2e-22
O183-wbaS


89 / 2e-22
O124-WfeS


87 / 1e-21
O164-WfeS


87 / 1e-21
O130-WffH'


84 / 1e-20
O55-WbgP


81 / 9e-20
O55-WbgP


81 / 9e-20
O66-WfaC


81 / 1e-19
O117-WbeA


81 / 1e-19
O125-O125_04


81 / 9e-20
O4-WbuG

aLRha(1->

->6)aDGlc

80 / 2e-19
NMR
1H-NMR5.49 4.35 4.04 4.26 4.00 3.73 3.76 2.11 4.90 3.85 3.75 3.51 3.40 3.73 3.92 2.07 4.66 3.77 3.79 4.19 4.25 3.70 3.70 4.05 3.70 3.70 4.50 3.38 3.71 3.81 3.81
Solvent: D2O
Temp: 62C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [3]
13C-NMR97.60 48.90 78.60 69.40 71.00 61.60 23.40 174.60 101.80 55.50 83.50 69.60 76.20 61.80 23.10 175.40 103.40 77.40 74.60 70.10 75.30 170.90 61.30 53.20 61.40 103.60 74.00 77.20 76.10 77.40 175.60
Solvent: D2O
Temp: 62C
pD:
Ref: Acetone 31.00 ppm
Comment: 13C-NMR [3]
Non-Sugar Components
- Acetate - 2-amino-propan-1 - 3-diol
Enzymes
FlippaseMSSFLRSIISVSALKLVDYIVPIIIMPLVLTRFNLEGYGVYSYVLTISTFISFIYDACLNTVGVQQLNKL KGNEIAQQSFVISAIFFKLVFFFVCAMVFIIISETAGKSDYFCVVIFSFGFGMLNSWYYIAKDNFRFIII VSLVVKILAVLFVLYYAFELHMFIFIQAIASALVGLISLIKIKNDNRLGKISFRHIKNYLKNIKHMYIYS GVNALIQPIINSAILASGNASLLGIYNVVMRFVTVSVTFSNSIITVLNKCNSEVFYSVGHKTNYVEVKYR SQLLKLLFYSIVVFICVAAISYVSIYLTKGEISRFFIFLIFSFSLAVIPSILNQYLTQLIHMIHSSKNIV KYVICSNVLSLISIFLFSSLFPYYYIVYAVVLSPIIITICCLWDLKCKNLL
Trembl: B5L391
PolymeraseMKVFFDVFLLFLFVFAFSIPVFFNSGYLIYIFSLIYLITNIRIRTVFFSLISTRIFFIAFLSLACMLFFS CISLVLNGTGDLSIMGVIFNNFAALFSSVIIASHLIQHNNDNVLKLFFLIALLQSFFIILMMFFPSINAY IQSIIRTKEEIEFMSNTYGGIRGLGISGSVAFGLAIIMSLLSFLSIVWFNEEDCNIPFFFKLFFIILLLF ASISAGRTAVLGFVLGGVYSFICSDYKKKFYRALQILIYVSLFLFIFWRFFLNEHVYDILKKYSDYSFQM LYYYLDSGKLSTTSTDALFNMYFPLTEKQIFIGDGYYTVKGWDILSRDRCWIYAVSIIFGCGTIGYFLFF IFYFFDYLCC
Trembl: B5L394
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • Methods Microbiology. 14. (1984), pp 43-112
  • First Author: Landersj√∂, C. "Structure determination of the O-antigen polysaccharide from the enteroinvasive Escherichia coli (EIEC) O143 by component analysis and NMR spectroscopy". Carbohydrate Research. 291. (1996), pp 209-216 PubMed: [8864232]
  • First Author: Zdorovenko EL. "Structure and gene cluster of the O antigen of Escherichia coli L-19, a candidate for a new O-serogroup". Microbiology. 160(Pt. (2014), pp 2012-2017 PubMed: [25061042]