O-Antigen Description

Serogroup:O167
Serotype H:5
Serotype K:
Strain:
Structure:
aDGalf(1->4)
          |
   ->2)bDGalA6NLAla(1->3)aDGlcNAc(1->2)bDGalf(1->5)bDGalf(1->3)bDGlcNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdF

GT NameDonorAcceptorScore / e-value
O85-WfbR


100 / 7e-26
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdG

bDGalA6NLAla(1->

->3)aDGlcNAc

2 |
GT NameDonorAcceptorScore / e-value
O143-WfdR


155 / 3e-46
O46-O046_03


94 / 3e-24
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdH

->3)aDGlcNAc

GT NameDonorAcceptorScore / e-value
O128-WbsK

bDGalNAc(1->

->4)aDGal

133 / 6e-38
O86-WbnJ

bDGal(1->

->3)aDGalNAc

129 / 1e-36
O86-WcmC

bDGal(1->

->3)aDGalNAc

129 / 8e-37
O86-WbwJ


128 / 2e-36
O125-O125_04


120 / 3e-33
O127-WbiP


119 / 5e-33
O90-O090_13


119 / 5e-33
O23-O023_06


115 / 9e-32
O74-O074_09


110 / 8e-30
O113-WbnA


108 / 1e-28
O55-WbgO


107 / 1e-28
O55-WbgO


107 / 1e-28
O54-O054_06


105 / 3e-28
O71-WdaK

bDGal(1->

->3)aDGalNAc

93 / 9e-24
O174-WbcZ


92 / 1e-23
O143-WfdT


92 / 3e-23
O64-O064_03


91 / 6e-23
O65-O065_13


91 / 4e-23
O178-O178_09


86 / 4e-21
O153-O153_06


86 / 4e-21
O92-O092_07


86 / 2e-21
O7-WbbD

bDGal(1->

->3)aDGlcNAc

84 / 2e-20
O112-WfeJ


84 / 2e-20
O22-WbhQ


84 / 9e-21
O185-O185_03


84 / 1e-20
O24-WfaM

bDGlc(1->

->3)bDGalNAc

83 / 3e-20
O171-O171_13


83 / 3e-20
O37-O037_13


83 / 2e-20
O28-O028ab_02


83 / 3e-20
O107-WclZ

bDGal(1->

->3)aDGalNAc

82 / 9e-20
O114-WbuP

bDGal(1->

->3)aDGlcNAc

82 / 7e-20
O5-O05_15


82 / 7e-20
O117-WbeD

bDGal(1->

->3)aDGalNAc

82 / 8e-20
O160-O160_08


81 / 1e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdI
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdJ

bDGalf(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O170-O170_08


105 / 1e-27
O170-O170_O4


104 / 2e-27
O124-WfeT

bDGalf(1->

->3)bDGalNAc

103 / 7e-27
O164-WfeT


103 / 7e-27
O85-WfbU

bDGalf(1->

->3)bDGlcNAc

98 / 4e-25
O167-WfdK

bDGalf(1->

->3)bDGlcNAc

95 / 5e-24
O96-O096_04


87 / 1e-21
O96-O096_08


84 / 2e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfdK

bDGalf(1->

->3)bDGlcNAc

6 |
GT NameDonorAcceptorScore / e-value
O85-WfbU

bDGalf(1->

->3)bDGlcNAc

309 / 8e-106
O170-O170_08


308 / 2e-105
O124-WfeT

bDGalf(1->

->3)bDGalNAc

307 / 7e-105
O164-WfeT


307 / 7e-105
O96-O096_08


267 / 4e-89
O42-WbeY

bDGalf(1->

->3)aDGlcNAc

234 / 2e-76
O28-WbeY

bDGalf(1->

->3)aDGlcNAc

233 / 5e-76
O170-O170_O4


163 / 5e-49
O167-WfdJ


95 / 4e-24
O96-O096_04


91 / 8e-23
NMR
1H-NMR5.23 4.16 4.23 4.06 3.86 3.70 3.70 5.03 4.03 4.07 4.15 3.94 3.73 3.73 5.01 4.09 4.00 3.62 3.88 3.85 3.92 2.08 8.47 4.90 4.02 4.23 3.83 3.80 3.66 3.70 4.68 3.82 3.66 3.48 3.44 3.76 3.91 2.05 8.21 4.65 3.59 3.75 4.25 4.21 1.35 7.65 4.16
Solvent: D2O
Temp: 60C
pD: 5.8
Ref: TSP 0.00 ppm
Comment: 1H-NMR [1], pD=5.8. Amid protons measured in H2O/D20 9:1 10C
13C-NMR106.70 87.60 75.80 82.80 70.90 63.70 109.00 82.00 77.30 82.50 76.80 62.30 97.60 53.30 79.70 69.50 73.20 61.50 23.10 174.40 103.70 76.60 73.50 81.20 70.20 63.80 102.50 55.80 81.70 69.20 76.00 61.90 23.10 175.00 101.70 79.50 73.30 79.40 74.20 169.10 18.00 180.00 51.30
Solvent: D2O
Temp: 60C
pD:
Ref: Acetone 31.00 ppm
Comment: 13C-NMR [1]
Non-Sugar Components
- L-Alanine
Enzymes
FlippaseMVKTDLTVFKNIISLFSIRFAGYIIPLITLPYLVKVLQPVGFGYLSFGIAVLQYCTLVVNYGFDLSATRK IAQNRENVHYISDIFWNILFLRLFISLVGFLVLVVFIHLFPDLYRIKWILLWGYLSVLGTALFPMWLFQG KEQLGRISAARIFLQISCVPLFFVFVKNTQDDWVASLIYALPQLLISVVAVYIIHKRKWIVLKKIKLATI KKELIDGWHLFISTAAISLYTTTITVVLGIVPGPYSVAIYTSANKILQAAQGLYQPISSAFYPRINNLIK ENKQLAFKTIRKLFKIQFVITICISVGLFLFSNIVVDILYGDDYRNAALILQLLSPIPIVVGCSNIFGIQ ILLTCGYKKEFSTILLISGLINMILIFPLCYKFNEFGAAFSVLITEIFVTVSMLFVVILKKIPVWESKRN V
Trembl: B5L3V7
PolymeraseMNNTLRQYSLVQVFITMYCLFPFYFHNIYIIQTFSLYSLALSFVVYTFFYKVRFVSRSGAITILASTTTF LIFLFMSMLINLSSDMTFVYEQVFGFSKQLLLALVPFCLYFSFDSDDINYAVHSILLLFIRAISLYVFIS VIFLIPEVRNYWIDIIYFSSDQNKELINSASYYTRFGLQGFSGFRHAILCAIALIFSIYLFMCGYKKIKN YWMSVFLVCIGCFLYGRIAIAVILCITLISLFYLLCKFEKLYFIFIVCLCVGTIACVVYMNIDYIQDSYS LAWIFEPLINFINEGQFTSHSTNDLSSMYIMPNENTMLLGDGKYTNHDGSYYMHTDVGFLRPVFFGGIFF VFFYYMMLILPLILIIKNSGLERRNILTLFLALALIVFELKGESFISFSAIIFSFILIPIICKRLN
Trembl: B5L3W2
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Linnerborg, M. "Structural studies of the O-antigenic polysaccharide from Escherichia coli O167". European Journal of Biochemistry. 246(2). (1997), pp 565-573 PubMed: [9208951]
  • First Author: Gross, RJ. "Enterotoxigenic and enteroinvasive Escherichia coli strains belonging to a new O group, O167". European Journal of Biochemistry. 17(3). (1983), pp 521-523 PubMed: [6341404]