O-Antigen Description

Serogroup:O159
Serotype H:20
Serotype K:
Strain:
Structure:
aLFuc(1->4)
         |
  ->3)bDGlcNAc(1->4)aDGalA(1->3)aLFuc(1->3)bDGlcNAc(1->
Comment:- Structure [2]
- Number of repeating units is approx. 23
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgP

GT NameDonorAcceptorScore / e-value
O173-WcmU

aLFuc(->

->4)aDGlc

81 / 7e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgQ
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgR

GT NameDonorAcceptorScore / e-value
O151-WbhW


152 / 4e-44
O118-WbhW


152 / 4e-44
O156-O156_09


108 / 2e-28
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgS

->4)aDGal

GT NameDonorAcceptorScore / e-value
O84-O084_13


493 / 0.0
O168-WfeY


483 / 0.0
O156-O156_14


482 / 0.0
O41-O041_12


476 / 0.0
O36-O036_15


468 / 0.0
O11-WdaG


265 / 6e-90
O125-O125_13


265 / 5e-90
O184-O184_15


260 / 4e-88
O43-O043_13


260 / 6e-88
O11-WdaD


126 / 3e-36
O43-O043_04


114 / 5e-32
O168-WfeV


106 / 6e-29
O173-WcmU

aLFuc(->

->4)aDGlc

103 / 6e-28
O111-WbdL

aDGlc(1->

->4)aDGal

97 / 3e-25
O36-O036_08


91 / 4e-23
O41-O041_06


85 / 2e-21
NMR
1H-NMR4.59 3.81 4.04 3.63 3.43 3.74 3.93 5.19 3.70 4.03 4.35 4.33 4.74 3.60 3.84 3.30 3.41 3.59 3.96 4.99 3.84 3.89 3.84 4.28 1.12 4.94 3.81 3.92 3.80 4.71 1.26 2.07 1.97
Solvent: D2O
Temp: 60C
pD: 7
Ref: TSP 0.00 ppm
Comment: 1H-NMR [1], pD=7
13C-NMR102.80 57.00 76.90 73.80 76.00 61.50 101.20 69.70 70.60 80.20 72.40 175.70 100.80 56.70 80.50 70.50 76.40 76.40 62.50 100.10 67.90 78.50 72.50 67.70 15.80 98.60 68.70 70.00 72.80 67.40 16.30
Solvent: D2O
Temp: 60C
pD: 7
Ref: Acetone 31.00 ppm
Comment: 13C-NMR [1], pD=7
Enzymes
FlippaseMQCSGSCKARGGSVENIENVCMVIKSSNGFGRIRINILLGFFSKFGSFILSYISLPIALSYLGVNYYGVW IVIFSVVAWIYNFDIGIGLGLKNSLNDALVKKNYKLANELIATAYIFLIAVSILLLLISFLLVFSINLDS IFSMSNIRESEIRTTLLVSVFFTIANFILLLYKQLFFAVNLSGFAAVTTILYQILVIVFLLVAKYFIEPS LLIVAIIYGVSNLFVGVFFTLYFFKRNDVLKFSFSNYKRNHIKSIGGVGIKFFIIQMCMLMIFTCDNIII SKYLGPEYVTSYSLILKTYQAFIMISYIILTPYWTLFAEAYYQKNTEWILKQYKKLYTLFLLMIIAVIAY SLYIQPLLKIWLHTELKFNKYMIYGFCIFVIIRVFIDLHAVFLNGIGKINVQLVLYLFAAIINIPLAIIL IKHFNMGSEAVIFSASIAIAPMAIILPLQSLVLFRNIAK
Trembl: B5L3L7
PolymeraseMVILKSRLIFLFFFVFLVLMVFYKIEANYFTPDEIFYLFSDSMLTDVTVASRYKFVAYIFRFIYEYGEYI SLLIVNITIVWFVINKLSKSSNNNDVNYLIYGFLFPSVVFYASLFLRDFYVFILAMLFVYVRRGKHKLFF QWCIILAIGFLKIELAAIFMCAMFISRIKISPFVIVYMFIICVLTWFLALHNQTLMGIYLNTLERFEPTV FSEYNTLFFGLQQMEPTPLNGAINIFFSYINLLSPFLISWPSNTGNIFNVIMTVDSILFLGCIIIGVLGF NTKKYYSDDLYRLSIFVLLLSIIYGYFMVTPMTSLRMHIHFVPLQYYFLWDLGLKYV
Trembl: B5L3M0
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Linnerborg, M. "Structural studies utilizing 13C-enrichment of the O-antigen polysaccharide from the enterotoxigenic Escherichia coli O159 cross-reacting with Shigella dysenteriae type 4". European Journal of Biochemistry. 266(1). (1999), pp 246-251 PubMed: [10542072]