O-Antigen Description

Serogroup:O152
Serotype H:
Serotype K:
Strain:
Structure:
bLRha(1->4)
         |
  ->3)aDGlcNAc(1->P-6)aDGlc(1->2)bDGlc(1->3)bDGlcNAc(1->
Comment:- Structure [3]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgB

bLRha(1->

GT NameDonorAcceptorScore / e-value
O115-WegG

bLRha(1->

->4)bDGlcNAc

290 / 7e-97
O105-WbsX


147 / 3e-42
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgC

aDGlc(1->

GT NameDonorAcceptorScore / e-value
O173-WcmV

aDGlc(1->

P->6)aDGlc

328 / 5e-112
O160-O160_07


191 / 4e-59
O181-O181_03


158 / 1e-46
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgD

bDGlc(1->

->3)bDGlcNAc

3 | 1
GT NameDonorAcceptorScore / e-value
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

235 / 4e-78
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

205 / 2e-66
O82-O082_09


194 / 3e-62
O165-WcnW


194 / 4e-62
O38-O038_09


183 / 5e-58
O140-O140_14


179 / 2e-56
O143-WfdV


167 / 8e-52
O112-WfeI


163 / 3e-50
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

159 / 1e-48
O81-O081_11


159 / 1e-48
O30-O030_06


157 / 6e-48
O134-O134_08


155 / 4e-47
O93-O093_02


154 / 1e-46
O46-O046_08


154 / 6e-47
O130-WffJ


146 / 8e-44
O21-WclQ


144 / 7e-43
O182-O182_10


144 / 3e-43
O79-WbdX


143 / 2e-42
O27-WejU


142 / 2e-42
O102-WelO

bDGlc(1->

->3)bDGalNAc

141 / 5e-42
O157-WbdN


135 / 1e-39
O24-WfaM

bDGlc(1->

->3)bDGalNAc

134 / 3e-39
O91-WbsA


132 / 2e-38
O61-WeiL


125 / 4e-36
O55-WbgP


97 / 2e-25
O55-WbgP


97 / 1e-25
O128-WbsK

bDGalNAc(1->

->4)aDGal

94 / 3e-24
O5-O05_12


90 / 1e-22
O113-WbnA


89 / 1e-22
O46-O046_05


86 / 3e-21
O134-O134_05


86 / 3e-21
O115-WegI


83 / 2e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgE

aDGlc(1->

->2)bDGlc

GT NameDonorAcceptorScore / e-value
O24-WfaO

aDGlc(1->

->2)bDGlc

561 / 0.0
O173-WcmX

aDGlc(1->

->2)bDGlc

325 / 1e-110
O56-WfaQ


275 / 2e-91
O29-WffY


173 / 4e-52
O18-wcxD


162 / 2e-48
O81-O081_10


154 / 7e-45
O130-WffI


149 / 3e-43
O144-O144_03


148 / 9e-43
O66-WfaB


143 / 5e-41
O102-WelN

aDGal(1->

->6)bDGlc

135 / 6e-38
O85-WfbQ


133 / 4e-37
O27-WejX


120 / 1e-32
O183-wbaT


116 / 2e-31
O169-O169_04


114 / 9e-31
O187-O187_10


110 / 3e-29
O65-O065_10


97 / 1e-24
O34-O034_11


92 / 4e-23
O110-O110_03


91 / 8e-23
O178-O178_05


83 / 6e-20
O153-O153_02


83 / 6e-20
O101-O101_06


81 / 5e-19
NMR
1H-NMR5.37 4.07 4.22 3.81 3.95 3.84 3.94 5.27 3.57 3.75 3.51 4.12 4.09 4.91 4.23 3.64 3.38 3.44 1.33 4.75 3.64 4.11 3.58 3.47 3.78 3.98 4.71 3.45 3.55 3.43 3.43 3.71 3.92
Solvent: D2O
Temp: 50C
pD:
Ref: TSP 0.00 ppm
Comment: 1H-NMR [1]
13C-NMR95.00 54.20 75.50 75.70 72.40 61.20 98.90 72.40 73.50 69.90 71.60 65.20 102.20 71.10 73.50 73.00 73.00 17.70 101.00 56.90 79.50 69.30 76.20 61.90 101.60 78.70 75.70 70.70 76.80 61.60
Solvent: D2O
Temp: 50C
pD:
Ref: Dioxane 67.4 ppm
Comment: 13C-NMR [1]
Non-Sugar Components
- Phosphorous
Enzymes
FlippaseMSIIKNSVWNLFGYAIPTLIAIPSLGFLARGLGPEGFGVYTIAIALVGYAGIFDVGLTRSVIREIAIHRD NHHERTKVISTSTSFLVLFSCFGAFLLLIFSDGIVNYLKISGVEHSDIQLAFKLLAICIPLFILNQLWSA ILEGDEKFGIVNIQKSISSSCIAGIPAIFVFYSATLSAAVAGLIFARVISILVSAYYVRNDIKISGVHFC YKTFKRLFFFGGWMTVSNIISPVMVYFDRFIVSNIMGADKVAFYSAPAEVILKLGIIPAAIGRAVFPRLS NIKDFKEFKRNVNKSLLLMFLICLPVIIIGLLYSGLVLKIWFGENYQISSFNILNVLLIGFFFNALAMIP FSAIQALGKSKITALIHCAELVPYLALLYFMVEKYGLLGAAISWSIRVILDALLLQWLYTRMCSVYEN
Trembl: B5L3E9
PolymeraseMLFTYASYLCILVFSTSVAFCYEHSKSNFKVLLWSVLFLSLWIPAAIRFGVGADYFRYLSMVESVRLGYI STEVGFYFINYFVVWFDLNPQWSIAISSFIVIFLSLKAIPRNYFSISVFVLVCTFYLPSFSLVRQAIAIA FIAYAVKNYIDGNKKNYIIFILIGSLFHLSALLLVPIYFIARFRVRSSILFLGILIISLLLFLGSGLNAL LNSEFFLQSKYGYYATSDFIQDAKIGSGVGVFIKMLLPLIFITNAKKILKTNQNLNILLWMSVGCVLANV CSMKIHIFNRLADIFLFVNFMVTSYIINSLEKNVIKQLSSMAIIIVFIVFYCRTIQANYNDDLGGIGISP YKTILSK
Trembl: B5L3F1
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Brockhausen, I. "Characterization of two beta-1,3-glucosyltransferases from Escherichia coli serotypes O56 and O152". Journal of Bacteriology. 190. (2008), pp 4922-32 PubMed: [18487334]
  • First Author: Olsson, U. "Structural analysis of the O-antigen polysaccharide from Escherichia coli O152". Carbohydrate Research. 340(1). (2005), pp 167-171 PubMed: [15620681]