O-Antigen Description

Serogroup:O187
Serotype H:
Serotype K:
Strain:559-59
Structure:
->2)bDFuc3NAc(1->3)aDGlcNAc(1->4)bDGlcA(1->3)aDMan(1->2)aDMan(1->3)bDGlcNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O187_08
GT nameDonorAcceptorPosition | Link.NumSimilar to
O187_10

GT NameDonorAcceptorScore / e-value
O18-wcxD


145 / 4e-42
O81-O081_10


130 / 2e-36
O173-WcmX

aDGlc(1->

->2)bDGlc

121 / 5e-33
O130-WffI


112 / 4e-30
O102-WelN

aDGal(1->

->6)bDGlc

112 / 6e-30
O152-WfgE


110 / 3e-29
O169-O169_04


109 / 5e-29
O24-WfaO

aDGlc(1->

->2)bDGlc

105 / 2e-27
O183-wbaT


104 / 2e-27
O29-WffY


103 / 4e-27
O56-WfaQ


103 / 4e-27
O144-O144_03


99 / 2e-25
O27-WejX


98 / 4e-25
O66-WfaB


90 / 3e-22
O110-O110_03


85 / 9e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
O187_11

GT NameDonorAcceptorScore / e-value
O175-O175_04


258 / 3e-85
GT nameDonorAcceptorPosition | Link.NumSimilar to
O187_12

aDMan(1->

->3)aDMan

GT NameDonorAcceptorScore / e-value
O144-O144_05


151 / 4e-44
O169-O169_06


132 / 5e-37
O183-wbaX


122 / 1e-33
O175-O175_05


120 / 9e-33
O88-O088_12


119 / 2e-32
O64-O064_19


111 / 6e-30
O9-MtfB

aDMan(1->

->3)aDMan

109 / 7e-29
O60-O060_11


108 / 7e-29
O36-O036_10


107 / 3e-28
O99-WejJ

aDRha(1->

->3)aDRha

105 / 2e-27
O7-WbbC

aDMan(1->

->4)bDGal

105 / 2e-27
O11-WdaF


93 / 2e-23
O9-MtfA

aDMan(1->

->2)aDMan

90 / 2e-22
O99-WejI

aDRha(1->

->2)aDRha

89 / 9e-22
O98-WbwV

aDGalNAcA(1->

->3)aLQuiNAc

86 / 5e-21
O125-O125_08


84 / 3e-20
O8-ORF469


82 / 1e-19
O43-O043_08


80 / 7e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O187_13

aDMan(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O34-O034_12


313 / 1e-106
O88-O088_13


305 / 2e-103
O58-WffE


301 / 6e-102
O115-WegL

aDMan(1->

->3)bDGlcNAc

301 / 6e-102
O144-O144_04


299 / 3e-101
O78-WejO


286 / 4e-96
O141-WfcD


261 / 5e-86
O99-WejK

DRha(1->

->?)?DGlcNAc ->?)?DGalNAc

152 / 1e-44
O175-O175_06


149 / 1e-43
O169-O169_07


147 / 6e-43
O60-O060_12


144 / 9e-42
O183-wbaY


142 / 6e-41
O9-WbdC

aDMan(1->

->2)aDMan ->3)aDMan

137 / 2e-39
NMR
1H-NMR4.60 3.69 4.04 3.60 3.87 1.22 5.43 3.98 3.94 3.58 3.78 3.80 5.22 3.59 3.95 3.75 4.15 5.01 4.19 3.92 3.87 3.76 3.78 3.84 5.46 4.05 3.83 3.71 3.52 3.79 4.55 3.70 3.70 3.46 3.35 3.67 3.89 1.99 2.10 2.12
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR102.6 75.3 56.2 71.4 73.2 16.6 98.4 53.6 81.2 69.4 72.8 61.5 102.1 73.4 75.2 77.7 74.4 176.9 103.5 71.3 80.1 67.3 74.5 62.2 101.1 80.1 71.3 67.9 74.7 62.2 23.6 23.8 23.9 174.8 175.0 175.5
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMNKLLSVTFLTGLLTFARMVAGFIVAKIVAIYTGPTGIAMLGQLQNVINGVSGLVNSPLN TSIVRFTAENYRTGYEECAIWWRVSIRWAIIIYAVIAPMMVVLSKQLSSFLFESDLYYWV IIASALALPFTAVGTLINSIINGQQLYIQYVLLGMVSVIISSMIMISLVVIKGVEGALIA LALQNAIIGIAMFGYGLRRPWFKLQYFFGNISKEQSKIILGYTFMALVSALTMPVVLMLI RKFLVMEVGWEHTGYWQAVWKISETYLAVVTMSLSIYYLPQLSSINDITSLRKEIYKTVK VVMPIVILMAFAIYMLRDIAISLLFTETFKGARDLFLVQLCGDVVKILSWLFAYALISRG ETKLFIASEAISAITFILLAFFCIKFYGVQGANIAYLANYVIYFILIYYCVFYRLKSHRC Q
Trembl: A0A075TE41
PolymeraseMLKLYKNKAQEYYLLICLFLCVFNFYVPSVGPALYISIAMVFVYLVVNIKSLCKYNSVIS RAYVSYIFIYGLPFLFLICFVGVRTILSGSGDTSFLFLLIKYFVFGCVASLFAVAIFISS EITSLSDVQALFYRITLVQSLIIIAAVLSPSISEFVRLYQNNDANNSSLVLEGLRGVALS SMQFYSLACYFCIITILLADDFINNKIGYLKTSVFLLLMAISSIFISRTAIIGVLLFFVY TLNPFIKYGKKRSVAMALMFLVLTLVFLLFSGLIFTEQVSIIQQKVLPWAFELIYRYSET GSFSTASTDELKSMYFSLNEITMLIGDGKYTGDTPGTYYMGTDAGYMRPTLFGGFFLILA MLVIWILWLKNTFYPKKGGVLFISLVILSLILQYKGEFIITNYCTLILLSTLLMVSQLLK QKFRG
Trembl: A0A075TAX1
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Senchenkova SN. "Structure and genetics of the O-antigens of Escherichia coli O182–O187". Carbohydrate Research. (2016),