O-Antigen Description

Serogroup:O125 ac
Serotype H:6
Serotype K:
Strain:Ew2129-54
Structure:
Comment:
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O125_04

bDGalNAc(1->

->4)aDGal

GT NameDonorAcceptorScore / e-value
O128-WbsK

bDGalNAc(1->

->4)aDGal

150 / 3e-44
O167-WfdH


120 / 3e-33
O113-WbnA


111 / 6e-30
O55-WbgO


106 / 3e-28
O55-WbgO


106 / 3e-28
O22-WbhQ


105 / 4e-28
O48-O048_06


103 / 5e-27
O65-O065_08


97 / 6e-25
O80-O080_10


97 / 5e-25
O5-O05_12


96 / 1e-24
O165-WcnW


95 / 2e-24
O74-O074_09


93 / 9e-24
O64-O064_03


91 / 4e-23
O27-WejU


91 / 3e-23
O92-O092_07


89 / 3e-22
O54-O054_06


87 / 1e-21
O61-WeiL


85 / 3e-21
O102-WelM

bDGalNAc(1->

->3)aDGal

85 / 1e-20
O112-WfeI


84 / 8e-21
O127-WbiP


84 / 7e-21
O90-O090_13


84 / 7e-21
O71-WdaK

bDGal(1->

->3)aDGalNAc

84 / 8e-21
O37-O037_11


84 / 2e-20
O130-WffH'


83 / 4e-20
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

83 / 3e-20
O86-WbnJ

bDGal(1->

->3)aDGalNAc

82 / 7e-20
O86-WcmC

bDGal(1->

->3)aDGalNAc

82 / 7e-20
O157-WbdN


82 / 8e-20
O82-O082_09


81 / 1e-19
O143-WfdV


81 / 1e-19
O86-WbwJ


80 / 2e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O125_05
GT nameDonorAcceptorPosition | Link.NumSimilar to
O125_08

GT NameDonorAcceptorScore / e-value
O36-O036_10


324 / 5e-111
O11-WdaF


288 / 1e-96
O184-O184_10


219 / 5e-70
O43-O043_08


194 / 1e-60
O88-O088_12


98 / 5e-25
O187-O187_12


84 / 3e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O125_13

aLFuc(->

->4)aDGlc

GT NameDonorAcceptorScore / e-value
O11-WdaG


506 / 0.0
O43-O043_13


496 / 0.0
O184-O184_15


386 / 2e-137
O41-O041_12


270 / 6e-92
O159-WfgS


265 / 6e-90
O36-O036_15


265 / 7e-90
O168-WfeY


263 / 4e-89
O84-O084_13


263 / 2e-89
O156-O156_14


262 / 1e-88
O11-WdaD


136 / 4e-40
O43-O043_04


122 / 1e-34
O173-WcmU

aLFuc(->

->4)aDGlc

119 / 9e-34
O168-WfeV


114 / 2e-31
O36-O036_08


110 / 2e-30
O111-WbdL

aDGlc(1->

->4)aDGal

106 / 2e-28
O41-O041_06


94 / 3e-24
O157-WbdO


85 / 2e-21
Enzymes
FlippaseMKVYNVFILNGLSVFVKMATLLGLNKVFAIYLGTSGYALIGQIQNILNIAMVAPSQAIST SIVKYTSEYKNSNKEKIWSFWINAIYLSTIMGFITAVIIIIFKNIIIEQFFNSNDKVSIA IYFLGGSVILYAWNNIILSMLNGLSFIKNYIWINIISSLISAIYAFILTISFGMRGALIA VVSNQAILFFVTFFYSKKYLREYYVNNCNRIDISILKRIIIFSLMTVTSAILVPVSTLYV RNEIITSINIEYAGLWDAVNRISSVYLMLITTTLGIYFFPRFSSASNRSELLNEIKVCYL YLVPLVCISSVLMYTFRGLIVNILFTHEFVPIVDVIVYQLIGDFFKIIAWVLGYLLISKA FVKEYIVLEVLQWSVYCILSKYSLCYVENAQISYVFKAYIISQALYMFSLIVTICYLLNK NKV
Trembl: A0A0A8J8D4
PolymeraseMIYKQYKLVLAQFYGFIGLIMIAVLSTSVKVEIDAILIWFLSVIFTIAIIFFVYNRMWVW FDGMFIILSPFYFFVSFLLYYFFGVNVFNVENNIINTSFLYCVAVWCIVASISLIRPHGI NIFLLNKQYNYDNNYNLFIPSCIAWLISLFFLYQSRNLSLNALGESTRLELINSVSQSGW YLKYVVIAYFWILLDLKVVKKNLTNYSFVIYSIPVLLYFYTLMLVGSRREIALSFIMAVL LSLYKAKFKIPLKVALFSILFVSTIILFGIYRSDYNVESSIRLLNALGEFIYPISTLQYY SSIHYQTQFFGISYLQFIVNFIPKELFMGLKPDTLAIQFAKEVYLPSQEFMMGYAFTPFT EAFINYNYYGVIIFPAILCGYSYIMERLIGNNYFLYLVFLSQSINFQRSEFSSMIFELGM FFMAYICLRLSMQIVFFKFK
Trembl: A0A0A8J6H1
Literature
  • First Author: Barros SF. "Escherichia coli O125ac:H6 encompasses atypical enteropathogenic E. coli strains that display the aggregative adherence pattern.". Journal of Clinical Microbiology. 46(12). (2008), pp 4052-4055 PubMed: [18923012]
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]