O-Antigen Description

Serogroup:O144
Serotype H:
Serotype K:
Strain:1624-56
Structure:
Comment:
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O144_03

aDGal(1->

->6)bDGlc

GT NameDonorAcceptorScore / e-value
O169-O169_04


309 / 3e-105
O183-wbaT


296 / 2e-100
O81-O081_10


181 / 2e-55
O102-WelN

aDGal(1->

->6)bDGlc

166 / 1e-49
O29-WffY


162 / 5e-48
O27-WejX


159 / 7e-47
O56-WfaQ


150 / 7e-44
O152-WfgE


148 / 9e-43
O66-WfaB


145 / 4e-42
O173-WcmX

aDGlc(1->

->2)bDGlc

131 / 1e-36
O24-WfaO

aDGlc(1->

->2)bDGlc

129 / 4e-36
O130-WffI


127 / 4e-35
O85-WfbQ


119 / 2e-32
O18-wcxD


112 / 4e-30
O187-O187_10


99 / 2e-25
O110-O110_03


89 / 3e-22
GT nameDonorAcceptorPosition | Link.NumSimilar to
O144_04

aDMan(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O141-WfcD


350 / 5e-121
O78-WejO


303 / 1e-102
O58-WffE


300 / 2e-101
O187-O187_13


299 / 3e-101
O88-O088_13


293 / 9e-99
O115-WegL

aDMan(1->

->3)bDGlcNAc

288 / 2e-96
O34-O034_12


264 / 9e-88
O169-O169_07


172 / 2e-52
O183-wbaY


155 / 8e-46
O99-WejK

DRha(1->

->?)?DGlcNAc ->?)?DGalNAc

154 / 3e-45
O175-O175_06


146 / 2e-42
O60-O060_12


141 / 2e-40
O9-WbdC

aDMan(1->

->2)aDMan ->3)aDMan

102 / 5e-27
O32-WfeE


84 / 4e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O144_05

aDMan(1->

->3)aDMan

GT NameDonorAcceptorScore / e-value
O169-O169_06


265 / 8e-88
O183-wbaX


247 / 5e-81
O175-O175_05


243 / 2e-79
O187-O187_12


151 / 4e-44
O88-O088_12


107 / 3e-28
O141-WfcC


94 / 1e-23
O184-O184_10


87 / 2e-21
O64-O064_19


82 / 6e-20
O9-MtfB

aDMan(1->

->3)aDMan

80 / 7e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O144_10

GT NameDonorAcceptorScore / e-value
O160-O160_05


181 / 2e-55
O112-WfeF


93 / 2e-23
O112-WfeM


87 / 1e-21
O160-O160_04


83 / 5e-20
Enzymes
FlippaseMSSIKKIVLNSSALYIRMIFVMLVNLLATRFLMANFGIDGFGLYNVISSIVVLGAFITGI LTVSSQRFISSGLAKAGHVGANDYLNAIFAVHILCFISIIIILEIFGYIYINGFLKQDVL PINDVYYIYHITVAGFSFSIFISFLNSICIAEENMSAYARFSILDATLKLLIAYSTLFVH KNTMIVYALAMLFEVIIMVFVMVIFIHRRYPYYKINNNYDFMKIKEVFSFVIWSLWGGVA TVLSNQGINLLLNYNFGVAINAARGVSMQINSAYLQIVNNFQFAINPQLVKSYASNDISR FERLFFLGSKVSILFSTIIFFILYVNINYVLSLWLINYSEDMVSFSKLIIIDAYITSFST AIILAIQASGRIKIYQSIVGVILLLNLPLSYAALKYWHEPQLVFVVSITLSILSLIFRML FLQKIVKIKFRSFLFVIIFPNICVFAIVSLVVNYNISLALTFQQFIINSVLITLLVIFLF IFIS
Trembl: A0A0A8J8R6
PolymeraseMNDRINMIRNENAIIIMATILAVIFLCCVSLSPLLGFYIPLMFLCIVCGNSKYIRMVLIL FSIYSASFFVASRNIFDANASDFDVYYDVYQIVNNGGTILYKDFSAGFEFFLPLFFKMIS FILGDASPQIVLAVTVFAQLFLLYIWLEWDGFKNVNPEDRNLCAASTFGLLFIYMFSQIL RQGFSSVFCLFAISFFLRKERLSFIIFYLLAISSHLTAIIIVPMFIIFMKNKKISMLICL GMFAFSGVFSLLLPFIVAHNLFGEMSYKFAFYTFTSLAGYDLSSYFKFLVITVIAGYFFF DNKNKYLKPLIYYGGLAYIALLPIPLASDRMLMVLAALLPGYILFFSFYKIKNIYKIILI LFFVLKVMTYGPFYDHKKDYDNPMQYWYTYPWINDTPFYYIH
Trembl: A0A0A8J6V2
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]