O-Antigen Description

Serogroup:O182
Serotype H:
Serotype K:
Strain:99-1287
Structure:
          ->4)bDGlcNAc(1->4)bDGlcA(1->3)bDGlcNAc(1->
                 |   
 bLRhaNAc3NAc(1->3)
Comment:- Strain is given for gene sequence data [1]
- Structure [2]
- Identical to the CPS of E. coli K48 [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O182_07

bLRhaNAc3NAc(1->

GT NameDonorAcceptorScore / e-value
O119-WekJ

aLRhaNAc3Fo(1->

->3)bDMan

174 / 1e-52
O109-weiN

bLRhaNAc3NAc(1->

->3)aDGlc

158 / 9e-47
O3-WclS


151 / 4e-44
GT nameDonorAcceptorPosition | Link.NumSimilar to
O182_09

GT NameDonorAcceptorScore / e-value
O170-O170_05


127 / 3e-36
O91-WbsG


120 / 9e-34
O38-O038_03


86 / 2e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
O182_10

bDGlcA(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

295 / 7e-102
O93-O093_02


286 / 4e-98
O91-WbsA


280 / 1e-95
O30-O030_06


276 / 2e-94
O79-WbdX


251 / 2e-84
O143-WfdV


175 / 9e-55
O140-O140_14


175 / 7e-55
O38-O038_09


172 / 1e-53
O165-WcnW


145 / 2e-43
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

144 / 3e-43
O112-WfeI


142 / 2e-42
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

135 / 1e-39
O46-O046_08


133 / 6e-39
O24-WfaM

bDGlc(1->

->3)bDGalNAc

132 / 2e-38
O134-O134_08


132 / 1e-38
O82-O082_09


130 / 1e-37
O157-WbdN


129 / 3e-37
O102-WelO

bDGlc(1->

->3)bDGalNAc

128 / 6e-37
O130-WffJ


123 / 5e-35
O21-WclQ


122 / 1e-34
O61-WeiL


119 / 1e-33
O81-O081_11


119 / 2e-33
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

115 / 3e-32
O27-WejU


114 / 8e-32
O55-WbgP


97 / 2e-25
O32-WfeA


97 / 4e-25
O55-WbgP


97 / 2e-25
O130-WffH'


94 / 4e-24
O48-O048_06


94 / 4e-24
O4-WbuG

aLRha(1->

->6)aDGlc

89 / 1e-22
O113-WbnA


82 / 4e-20
O128-WbsK

bDGalNAc(1->

->4)aDGal

81 / 7e-20
O34-O034_10


80 / 2e-19
NMR
1H-NMR5.04 4.53 3.95 3.26 3.49 1.34 4.57 3.66 3.83 3.85 3.44 3.68 3.88 4.53 3.38 3.61 3.78 3.88 4.50 3.86 3.77 3.55 3.40 3.83 3.89 1.94 2.00 2.02 2.03
Solvent: D2O
Temp:
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR100.2 52.7 55.1 71.5 74.9 18.4 102.1 55.3 79.2 76.7 76.4 61.2 104.0 73.7 75.0 81.3 76.2 173.5 101.6 56.4 83.5 70.4 77.2 62.4 175.3 175.4 175.7 176.0 23.2 23.4 23.5 23.9
Solvent: D2O
Temp:
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMLYFGKFGALAVGFFLMPAYSYYLGPASFSTVAFILSLVNAAVTLDFGMSTIIGRDSSDS TISNDKKYKQFLASQFLVIFFYLSVFSIVAIYSFLFQKGDLGVKISFLSVILIMSSLIQN ISVSYLNGIKEFKISGSLIFLSVTLRGVISLLVIKYIDNNIISFMSAQSIIGLLFSLIFM LLPSRLDKEIKINNSWGGFFEPSIYIKFLLPLVKKGFPLLFMGVSATLVMQFDKIILSYY ASDATLSAYYLAFTFSTIPILAIAGPIKQYFQPHIVSYLTQNNVLYRKNSIVFFWCLIVF VAVPSALGYSSLYQILSIWLGNNELIDKVDFFSHILLPAFVLGAISYFPSVLLVVAEDYR FQSVFAIITSIIFVFLLFILAISSNVRFIPWLFIGYFCVVILFCSIRCFSLTKVNLCIFD MVKNSPFAILIIALSYWVGNIVSAMIF
Trembl: A0A0B1DH07
PolymeraseMSENILSRLTLNSAQKCLLTGLIIILLGPYGGALGFALVVCGAGLEKGRIERYILCVFSF FIFTLCSVQGVFHSSNFNTISLFTALCTVMVLFLVDNNSLILILDKLIFVISVTVPIALI IAISQTLGVYPFEFRSNEVLGVMRFTFLFAEPSHYSILLSLCSLISLVKKTNLFTRFILL FGLLMTWSLSGFCIFTFGYIAYKFYTRGIIKYFIISLLLGSIITFLWFFKLQYSDFWLVA KIDSIIQLFSGNTVGASSALLRFNSIIIGPYFINEKINSDNFLLSFFGLGFGNLSDFVSV YYQSNFGLPDVYDANNIISNVIISSGIVGLVFYILSFSYFTGLNLVNILFAAIILLCLSL FSGYAFGPFAILTLLLSRAFILLVINHDKARINRCTYFNTWFENKTGS
Trembl: A0A0A8J9L6
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Senchenkova SN. "Structure and genetics of the O-antigens of Escherichia coli O182–O187". Carbohydrate Research. (2016),