O-Antigen Description

Serogroup:O183
Serotype H:18
Serotype K:
Strain:EHOUT32
Structure:
bDRibf(1->4)bDGlcA(1->4)
                      |   
               ->3)bDGal(1->6)aDMan(1->2)aDMan(1->3)bDGalNAc(1->
Comment:- Structure [2]
- Identical to the OPS of Shigella boydii type 10 [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
wbaS

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O169-O169_03


621 / 0.0
O76-O076_07


98 / 3e-25
O38-O038_09


93 / 8e-24
O143-WfdV


89 / 2e-22
O165-WcnW


88 / 4e-22
O24-WfaM

bDGlc(1->

->3)bDGalNAc

87 / 8e-22
O46-O046_08


85 / 5e-21
O134-O134_08


84 / 1e-20
O82-O082_09


83 / 2e-20
O149-WbuU


82 / 4e-20
O157-WbdN


80 / 3e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
wbaT

GT NameDonorAcceptorScore / e-value
O169-O169_04


614 / 0.0
O144-O144_03


296 / 2e-100
O81-O081_10


161 / 5e-48
O29-WffY


139 / 2e-39
O27-WejX


135 / 3e-38
O56-WfaQ


127 / 2e-35
O130-WffI


122 / 1e-33
O66-WfaB


120 / 9e-33
O152-WfgE


116 / 2e-31
O173-WcmX

aDGlc(1->

->2)bDGlc

115 / 6e-31
O102-WelN

aDGal(1->

->6)bDGlc

114 / 1e-30
O18-wcxD


111 / 8e-30
O187-O187_10


104 / 2e-27
O24-WfaO

aDGlc(1->

->2)bDGlc

103 / 5e-27
O110-O110_03


92 / 3e-23
O65-O065_10


84 / 3e-20
O85-WfbQ


83 / 7e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
wbaX

GT NameDonorAcceptorScore / e-value
O169-O169_06


594 / 0.0
O144-O144_05


256 / 1e-84
O175-O175_05


252 / 4e-83
O187-O187_12


130 / 9e-37
O88-O088_12


100 / 4e-26
O141-WfcC


91 / 1e-22
O59-WclB


80 / 6e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
wbaY

aDMan(1->

GT NameDonorAcceptorScore / e-value
O169-O169_07


612 / 0.0
O175-O175_06


308 / 8e-105
O144-O144_04


155 / 7e-46
O115-WegL

aDMan(1->

->3)bDGlcNAc

146 / 3e-42
O58-WffE


142 / 6e-41
O187-O187_13


142 / 6e-41
O78-WejO


141 / 3e-40
O34-O034_12


133 / 1e-37
O88-O088_13


129 / 2e-36
O141-WfcD


126 / 7e-35
O99-WejK

DRha(1->

->?)?DGlcNAc ->?)?DGalNAc

120 / 5e-33
O60-O060_12


119 / 2e-32
O9-WbdC

aDMan(1->

->2)aDMan ->3)aDMan

99 / 9e-26
Enzymes
FlippaseMSIFNNLKWNAISQLFKIATQLISMIYLARLIAPEDYGIMAMATVVTNFAILFRDLGTSA AIVQRDSIDESLKSAIFWLNLLLGIIVGTAILFSSSYFSELYDVPKLKPVLSLLSINFFL LGATSVHLSLLERESKFETISKIEIFSFGSALIIAIAMAYLNFGVYSLVTQSIVSTLLSS GLFWYLSSWSPRIKIENIFKNTKSIFSFSYQLSLFNFINYFARNLDSFLIGKYMSATILG AYNLAYRIMLFPLTSITFIVNRSLFPILSKNKHKHAEVEKIYLNTVYTIWFITIPLIISL LCLNEMVINIIFGEKWHLSSSILVWLAPTAIIQSILSTTGIIFMSQGRTGILVLLGVQGA ILTGIAFVIGVNDNITSLAKYYFIANLVHFFPCMALTMYVIKSNFYKLILKTYPLFIAGF ISYCVIYILKKHLDHSFLSLVILTIICFVVFIVSLLPTKEVKNFINRLIK
Trembl: G3XGB7
PolymeraseMIIITSFMVLLFLFTDNLKLKNFRIILFYFFSLCFSVLVYFRPEYMLNTDYKEYYNYFKW INFDNIYNLSDAIGFEYGFGYIVTLLKYFFESERACFSGIAFLSVFISYKAILRLNPKTT AFSFSLFLLSFCVYIFLGQIRQGISLSLGLLAISYLLEDKRKQFLLTVIIASSIHVTALI LILAPFVKYFRIKYIFYSLLLSFAFVFIDVIKPLIITLAQFIPFGSFITGKIIAYGNSEF STKVGFSFIQVYYVLLSTVLYILVKKYEYKNNYILILCKIFMVGVILNFTFNSFSVLLRI TYYYLALDCILLGYLLNMAKNGYTKILIYCPTLMLFILRFYMQWSEHING
Trembl: G3XGB1
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Senchenkova SN. "Structure and genetics of the O-antigens of Escherichia coli O182–O187". Carbohydrate Research. (2016),