O-Antigen Description

Serogroup:O184
Serotype H:
Serotype K:
Strain:99-4473
Structure:
->2)aDFuc3NBuR3OH(1->3)aDMan6Ac(1->3)aLFuc(1->3)aDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O184_08
GT nameDonorAcceptorPosition | Link.NumSimilar to
O184_10

GT NameDonorAcceptorScore / e-value
O43-O043_08


320 / 3e-109
O11-WdaF


231 / 8e-75
O36-O036_10


225 / 2e-72
O125-O125_08


219 / 5e-70
O99-WejJ

aDRha(1->

->3)aDRha

89 / 6e-22
O144-O144_05


87 / 2e-21
O64-O064_19


81 / 1e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O184_15

GT NameDonorAcceptorScore / e-value
O125-O125_13


386 / 2e-137
O43-O043_13


385 / 4e-137
O11-WdaG


381 / 1e-135
O41-O041_12


265 / 6e-90
O168-WfeY


263 / 3e-89
O156-O156_14


262 / 7e-89
O84-O084_13


261 / 1e-88
O159-WfgS


260 / 4e-88
O36-O036_15


259 / 1e-87
O11-WdaD


133 / 7e-39
O43-O043_04


123 / 3e-35
O111-WbdL

aDGlc(1->

->4)aDGal

110 / 5e-30
O173-WcmU

aLFuc(->

->4)aDGlc

108 / 2e-29
O36-O036_08


103 / 1e-27
O168-WfeV


102 / 2e-27
O41-O041_06


87 / 5e-22
O157-WbdO


84 / 5e-21
NMR
1H-NMR5.62 3.92 4.49 3.77 4.23 1.23 5.11 4.19 4.07 3.74 3.79 3.71 3.86 4.93 3.84 4.01 3.96 4.10 1.19 5.22 4.45 3.73 4.00 3.85 3.76 3.79 2.45 2.53 4.23 1.25 2.06
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR96.7 69.8 50.2 71.9 68.5 16.5 102.9 71.2 76.0 68.7 74.7 62.1 102.6 68.7 78.4 72.7 68.3 16.7 94.7 49.5 77.3 70.0 72.7 62.1 175.4 46.0 66.2 23.7 23.7 176.2
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Non-Sugar Components
- Acetate - (R)-3-hydroxybutyryl
Enzymes
FlippaseMKRLLKVSALSGMLTLLKMLMGFIIAKVIAVYTGPAGMAMLGQIQNIINSFNGIVNSPVS NGVVRFTAENNKSGFYKCSPWWRASLEWLIILCVITIPLGFLFSDYLSTWLFETKEFGWL IKLTVIFLPLTAFGTLISSVINGLENFRRYIILIMVSVLISSCLMIVMIIYAGLKGALIA AVFQSSMIGAVMLLTNIKQPWFSLTYWWGNTNSKARKDIAGYILMAVTSAITAPLSLILV RNIIIYHSGWEQAGQWQAVWKISEVYLSIITISLSTYFLPKLASKADVGGIIQEINKTAL IVIPLAIIMAVVVYAGRDIAIYILFTEQFRAARELFAIQLLGDIVKIISWLYAYPMLSRG ATKWYVSTEILFSASFVILSWFLVGEYGNAHGANVAYLINYTFYFLFIIVNFKKIIK
Trembl: A0A0A8J6L5
PolymeraseMPIAVYFIEFAYVMIVLLFILYYNSRNMPFIEGLFLILIICSPYSISIIPFRQDMYEIYG IYSNNGILNIVNFYKIAGLSILDMMALLIIVININTVMKIPSFFIMFYFLVGCFSIIGYS ISSYLFWSPELDNIFNILSVFKSIIYIISVYCAIDRICKHIGFDKFIKFLANLILCYCII NALILCFLPDWYTWVKYSFNYLFLDQTDQFLVFLYCLLAVWGPLSGIHRYKIYALILCIM LLLSGGKGGVYSLVILAMAWLYKNSNINSAILSICFFLIMILSWMLSYYIGFNVFDLSIY TRYFQVNQLFLNYMNNILTIFFGIGPSKAYFFYSEPAILDPGAYTSSELNSSFKIGFQMP YLTWIKNFGLSGLILLYLSLNYVVKTARHSKSNEAYFSGIVYALGLYFLLVGFMDFPSFG LKTIIPISLYIYIVKMNATNIHCEGRK
Trembl: A0A0A8J752
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Senchenkova SN. "Structure and genetics of the O-antigens of Escherichia coli O182–O187". Carbohydrate Research. (2016),