O-Antigen Description

Serogroup:O185
Serotype H:
Serotype K:
Strain:99-6301
Structure:
->4)bDGalNAc(1->2)bDGlcA(1->3)bDRibf(1->4)bDGal(1->3)aDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O185_03

bDGal(1->

->3)aDGalNAc

GT NameDonorAcceptorScore / e-value
O146-WbwW


279 / 9e-95
O5-O05_15


276 / 2e-93
O71-WdaK

bDGal(1->

->3)aDGalNAc

271 / 1e-91
O37-O037_13


268 / 3e-90
O112-WfeJ


251 / 5e-84
O104-WbwC

bDGal(1->

->3)bDGalNAc

251 / 1e-83
O171-O171_13


242 / 3e-80
O33-O033_09


238 / 1e-78
O174-WbcZ


235 / 1e-77
O160-O160_08


231 / 3e-76
O178-O178_09


223 / 5e-73
O153-O153_06


223 / 5e-73
O70-O070_13


213 / 4e-69
O155-WclG


210 / 5e-68
O107-WclZ

bDGal(1->

->3)aDGalNAc

194 / 1e-61
O117-WbeD

bDGal(1->

->3)aDGalNAc

191 / 1e-60
O131-O131_11


190 / 4e-60
O7-WbbD

bDGal(1->

->3)aDGlcNAc

171 / 8e-53
O65-O065_13


158 / 8e-48
O28-O028ab_02


120 / 2e-33
O54-O054_06


107 / 6e-29
O23-O023_06


101 / 7e-27
O64-O064_03


97 / 4e-25
O63-WbuP


95 / 1e-24
O127-WbiP


92 / 9e-24
O90-O090_13


92 / 9e-24
O74-O074_09


89 / 2e-22
O114-WbuP

bDGal(1->

->3)aDGlcNAc

88 / 4e-22
O128-WbsK

bDGalNAc(1->

->4)aDGal

86 / 3e-21
O92-O092_07


86 / 1e-21
O167-WfdH


84 / 1e-20
O113-WbnA


83 / 3e-20
O86-WbnJ

bDGal(1->

->3)aDGalNAc

81 / 1e-19
O86-WbwJ


81 / 1e-19
O86-WcmC

bDGal(1->

->3)aDGalNAc

80 / 1e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O185_07

GT NameDonorAcceptorScore / e-value
O27-WejW


154 / 7e-46
O32-WfeA


92 / 3e-23
O83-O083_04


91 / 5e-23
O165-WcnW


82 / 4e-20
O38-O038_09


80 / 2e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O185_09

GT NameDonorAcceptorScore / e-value
O124-WfeS


98 / 4e-25
O164-WfeS


98 / 4e-25
O117-WbeA


92 / 3e-23
O107-WclW


90 / 1e-22
O160-O160_04


88 / 8e-22
O112-WfeM


82 / 7e-20
O112-WfeF


82 / 1e-19
O42-WbeX

bDGlcNAc(1->

->3)bDGalf

81 / 3e-19
O28-WbeX

bDGlcNAc(1->

->3)bDGalf

81 / 4e-19
NMR
1H-NMR4.54 3.96 3.77 3.99 3.73 3.74 4.57 3.43 3.63 3.81 3.82 5.28 4.31 4.22 4.12 3.71 3.86 4.52 3.51 3.74 4.00 3.70 3.74 4.90 4.37 4.15 4.27 4.42 3.67 3.70 2.05 2.06
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR102.7 53.7 71.8 76.9d 76.9 61.8 104.4 73.8 75.0 81.0 77.1 175.0 109.9 75.7 80.8 82.1 63.9 106.1 71.9 74.2 77.0d 75.7 62.5 99.9 50.2 78.1 69.7 71.5 61.8 23.3 23.8 175.8 176.5
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMLLITGVKWVALSQIARALSQLVLIFVLARYLTPYDYGLISIVSVVAAFAMLFRDMGTSS ILIQRRRISENFIKSTYTLNFISGLVIFIVMTLLAYPISLFYNDTRLFLLILIISFSFPL QSFIAFNFALLERNQQFNITALIELISLSISIIVVFIVIAMGFGLYAVSLQALLYAVIVV FLLSLKNRRKYKFSWRMKYIKLIFGYCVNVMSFNMVNYFSRNADNIIVGKIFGQYVLGNY ALAYRLMLFPVQNITYIFNRALLPKLSHSKDIITKKRIYLDSLKFIAVLSIPAMIGLASL SNELVFFLFGKNWDNAALLLKWLAPVGIIQALTSTTGVVFLSLGNVKLLARIGCVSAIIQ VMSFVIGACFNIVIFCQLYLCANVLIFYICFYYVMRLLQGNIKNILCITCKPLFCSVCML ILILIAKNNFITQSNNMELLSLIYYIVIGAGSYVCLMFIIDKNTIVGLLNNALPKRK
Trembl: A0A0A8J9P0
PolymeraseMNNSAIIVFVDSIIIAFFIVGYLLNEAGFVSVDYYTLAISCFLFIAFAYLQTALLSGVLS IISLFIMTISIFIFGRIFSYLLYSEMDYYTVTLFYTTTISSLDSVNLLLTIGIIIYSILL GYFFTQCIENKNKNVNVVTYNLRLPNGPVLFLVGCLVFPYIYSGLEAVNSGGYLSFYTKN LELLEKGSIIPNLYSLGITIATVFLSISISTDNKKNTNFYLCVLLMNSLMLAFIGQRGPL LSFFLFYLWYRNKYIKKIPLLRLVIIGGIAIVFSQTLLLFRADYSNSNINLFEHYFSFLF QQGVTLHVIYFTKYIDNFPGYLLAQNFIPGANAIYNMFAEHTILYNSSSAYLSDLLNPAL FKSGYGVGWSFVNDIVLLCNKNVGAMIIVACLFGVFLSLAENRGNSKGLYITALSVITAY RIGFLPRAGLNGIFPLWIYSLVIITLLMVLKKKWKN
Trembl: A0A0A8J7T5
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Senchenkova SN. "Structure and genetics of the O-antigens of Escherichia coli O182–O187". Carbohydrate Research. (2016),