O-Antigen Description

Serogroup:O46
Serotype H:
Serotype K:
Strain:G3214
Structure:
->4)bDGlcA6LThr(1->6)bDGal(1->6)bDGlc(1->3)bDGalNAc(1->
Comment:- Structure [2]
- LThr and bDGalNAc are O-Acetylated to 70%/30% and 15% respectively
- Strain for gene sequence determination was P1c [1]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O046_03

GT NameDonorAcceptorScore / e-value
O143-WfdR


97 / 5e-25
O167-WfdG

bDGalA6NLAla(1->

->3)aDGlcNAc

94 / 3e-24
GT nameDonorAcceptorPosition | Link.NumSimilar to
O046_05

bDGlc(1->

GT NameDonorAcceptorScore / e-value
O134-O134_05


618 / 0.0
O32-WfeA


200 / 4e-63
O83-O083_04


175 / 8e-54
O165-WcnW


90 / 1e-22
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

86 / 3e-21
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

86 / 3e-21
O112-WfeI


82 / 6e-20
O55-WbgP


81 / 9e-20
O55-WbgP


81 / 8e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O046_07

GT NameDonorAcceptorScore / e-value
O134-O134_07


534 / 0.0
O64-O064_06


95 / 2e-24
GT nameDonorAcceptorPosition | Link.NumSimilar to
O046_08

bDGlc(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O134-O134_08


494 / 0.0
O130-WffJ


255 / 3e-86
O27-WejU


248 / 1e-83
O21-WclQ


233 / 1e-77
O157-WbdN


223 / 2e-73
O81-O081_11


223 / 1e-73
O24-WfaM

bDGlc(1->

->3)bDGalNAc

221 / 7e-73
O61-WeiL


221 / 4e-73
O102-WelO

bDGlc(1->

->3)bDGalNAc

212 / 2e-69
O112-WfeI


199 / 2e-64
O38-O038_09


195 / 9e-63
O143-WfdV


179 / 1e-56
O140-O140_14


160 / 3e-49
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

154 / 6e-47
O165-WcnW


144 / 3e-43
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

137 / 1e-40
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

136 / 4e-40
O93-O093_02


135 / 1e-39
O182-O182_10


133 / 6e-39
O30-O030_06


129 / 3e-37
O91-WbsA


125 / 7e-36
O82-O082_09


123 / 4e-35
O79-WbdX


120 / 4e-34
O128-WbsK

bDGalNAc(1->

->4)aDGal

120 / 1e-33
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

100 / 7e-27
O113-WbnA


94 / 4e-24
O12-O012_O2


86 / 1e-21
O183-wbaS


85 / 4e-21
O169-O169_03


85 / 3e-21
O55-WbgP


83 / 9e-21
O32-WfeA


83 / 1e-20
O55-WbgP


83 / 9e-21
O66-WfaC


81 / 5e-20
O5-O05_12


81 / 9e-20
NMR
1H-NMR4.60 3.40 3.67 3.97 4.11 4.37 3.53 3.62 3.92 3.86 3.93 4.00 4.51 3.28 3.46 3.45 3.58 3.78 4.20 4.49 4.00 3.85 4.17 3.65 3.75 3.82 4.45 4.41 1.25
Solvent: 1
Temp: 20C/30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
Chemical shifts are given for O-deacetylated samples
13C-NMR104.3 73.6 74.9 78.3 75.0 171.7 104.7 71.8 73.8 69.8 75.0 70.8 105.4 74.1 76.7 70.7 75.8 70.0 100.9 52.4 81.4 69.0 76.1 62.2 175.2 60.2 68.4 20.3
Solvent: D2O
Temp: 20C/30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Chemical shifts are given for O-deacetylated samples
Non-Sugar Components
- Acetate - Allothreonine
Enzymes
FlippaseMKIIYNTLWMIFEKLVLSLSLLIINAYVARYLGPQQYGVIAYSITLLSISVVISNFGTNT LIFQKISKNHSVAKIIIPPIQILKTILYIICILIMFFCLYIFSYDFDPYLTFGLAVAFYF QAIDSYTWYNDAKLKSKYNSLINTIALIGAIISRYYLVKLSMDLKWFAIPYVCNYGISFL LKRYFYIKEEKTKSIKSFIFEKKDHTLKVISFFIISGAPLFLSEISILIYTRLTNLYLGQ IKDIDAVGIFNASYVLATAWTVVPLAFVTSVFTIIYKEKDISNRALIGTFLTLLMLFFGF LLVILCYFFKQQIISIVWLRFRVIFFYITCTYSWLSFLSFRCYFLSDDNINAWVQIYSKK DGYYGGDKYSIKLLSY
Trembl: A0A0A8J6K0
PolymeraseMKTNNKKIKALIFFISIFLYFFKSVFISLELPEDLIGGVSNIINALILAILSPVILLSNK KQCAFIIFLIILFVYNAIFYNNIYMFGFIIIACMLILSNGIYWRDIIRYLSLAHFLVFLF IIPLVFFAEKYSFIDDRFGVRYTFGFHNPNTFSQYLISLYVVFLLLFVEVIKKKSLQFLT VIILTLFIYGVISLTGSRTGMILTIITGFGFLACTLSKTNDKKRRKFVYLYILGAGILCF IQYYLALTYNHSEFSKNINTILSGRIWFSSQLTSQLWPVPYFHGVNINDYLPIDFFYVAY FYNLGIFIGSWFIYLFIRKMFVQTYTPVMVIALWLSLAITVTENYYAIPLYNISLFIVFS SRYVINENENSCTYPSSQK
Trembl: A0A0A8J6L6
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Perepolov AV. "Structures and gene clusters of the closely related O-antigens of Escherichia coli O46 and O134, both containing D-glucuronoyl-D-allothreonine". Carbohydrate Research. 409. (2015), pp 20-24 PubMed: [25898391]