O-Antigen Description

Serogroup:O134
Serotype H:35
Serotype K:-
Strain:CCUG11434
Structure:
->4)bDGlcA6LThr(1->6)bDGal(1->6)bDGlc(1->3)bDGalNAc(1->
Comment:- Structure [2]
- Same structure as O46 but lacks O-acetylation
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O134_05

bDGlc(1->

GT NameDonorAcceptorScore / e-value
O46-O046_05


618 / 0.0
O32-WfeA


200 / 4e-63
O83-O083_04


175 / 8e-54
O165-WcnW


90 / 1e-22
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

86 / 3e-21
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

86 / 3e-21
O112-WfeI


82 / 6e-20
O55-WbgP


81 / 9e-20
O55-WbgP


81 / 8e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O134_07

GT NameDonorAcceptorScore / e-value
O46-O046_07


534 / 0.0
O64-O064_06


88 / 4e-22
GT nameDonorAcceptorPosition | Link.NumSimilar to
O134_08

bDGlc(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O46-O046_08


494 / 0.0
O130-WffJ


252 / 5e-85
O27-WejU


249 / 5e-84
O21-WclQ


236 / 1e-78
O157-WbdN


225 / 2e-74
O81-O081_11


222 / 7e-73
O61-WeiL


221 / 6e-73
O24-WfaM

bDGlc(1->

->3)bDGalNAc

218 / 1e-71
O102-WelO

bDGlc(1->

->3)bDGalNAc

209 / 2e-68
O112-WfeI


200 / 7e-65
O38-O038_09


197 / 8e-64
O143-WfdV


180 / 9e-57
O140-O140_14


160 / 2e-49
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

155 / 4e-47
O165-WcnW


150 / 2e-45
O93-O093_02


135 / 9e-40
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

135 / 1e-39
O182-O182_10


132 / 1e-38
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

131 / 4e-38
O30-O030_06


129 / 2e-37
O91-WbsA


124 / 2e-35
O82-O082_09


121 / 1e-34
O128-WbsK

bDGalNAc(1->

->4)aDGal

120 / 1e-33
O79-WbdX


119 / 2e-33
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

102 / 2e-27
O113-WbnA


94 / 3e-24
O12-O012_O2


86 / 1e-21
O55-WbgP


84 / 6e-21
O32-WfeA


84 / 9e-21
O55-WbgP


84 / 6e-21
O183-wbaS


84 / 1e-20
O169-O169_03


84 / 9e-21
O66-WfaC


81 / 6e-20
O5-O05_12


81 / 8e-20
NMR
1H-NMR4.60 3.40 3.67 3.97 4.11 4.37 3.53 3.62 3.92 3.86 3.93 4.00 4.51 3.28 3.46 3.45 3.58 3.78 4.20 4.49 4.00 3.85 4.17 3.65 3.75 3.82 4.45 4.41 1.25
Solvent: 1
Temp: 20C/30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR104.3 73.6 74.9 78.3 75.0 171.7 104.7 71.8 73.8 69.8 75.0 70.8 105.4 74.1 76.7 70.7 75.8 70.0 100.9 52.4 81.4 69.0 76.1 62.2 175.2 60.2 68.4 20.3
Solvent: D2O
Temp: 20C/30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Non-Sugar Components
- Acetate - Allothreonine
Enzymes
FlippaseMKIIYNTLWMIFEKLVLSLSLLIINAYVARYLGPQQYGVIAYSITLLSISVVISNFGTNT LIFQKISKNHSVAKIIIPPIQILKTILYIICILIMFFCLYIFSYDFDPYLTFGLAVAFYF QAIDSYTWYNDAKLKSKYNSLINTIALIGAIISRYYLVKLSMDLKWFAIPYVCNYGISFL LKRYFYIKEEKTKSIKSFIFEKKDHTLKVISFFIISGAPLFLSEISILIYTRLTNLYLGQ IKDIDAVGIFNASYVLATAWTVVPLAFVTSVFTIIYKEKDISNRALIGTFLTLLMLFFGF LLVILCYFFKQQIISIVYGSGFELSSSILPVLILGSVFSLLGVISYRMIISMHGYKYIAK KMVIMGVISIPLNYYLIKSLGIIGAAYATVSIELISATLANYFFKGGVIAKMHLKMITSP YSVSMQAITKILK
Trembl: A0A0A8J8K4
PolymeraseMKTNNKKIKALIFFISIFLYFFKSVFISLELPEDLIGGVSNIINALILAILSPVILLSNK KQCAFIIFLIILFVYNAIFYNNIYMFGFIIIACMLILSNGIYWRDIIRYLSLAHFLVFLF IIPLVFFAEKYSFIDDRFGVRYTFGFHNPNTFSQYLISLYVVFLLLFVEVIKKKSLQFLT VIILTLFIYGVISLTGSRTGMILTIITGFGFLACTLSKTNDKKRRKFVYLYILGAGILCF IQYYLALTYNHSEFSKNINTILSGRIWFSSQLTSQLWPVPYFHGVNINDYLPIDFFYVAY FYNLGIFIGSWFIYLFIRKMFVQTYTPVMVIALWLSLAITVTENYYAIPLYNISLFIVFS SRYVINENENSCTYPSSQK
Trembl: A0A0A8J6L6
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Perepolov AV. "Structures and gene clusters of the closely related O-antigens of Escherichia coli O46 and O134, both containing D-glucuronoyl-D-allothreonine". Carbohydrate Research. 409. (2015), pp 20-24 PubMed: [25898391]