O-Antigen Description

Serogroup:O140
Serotype H:
Serotype K:
Strain:G3116
Structure:
aDGalf(1->2)aLRha(1->4)
                     |
              ->3)bDGal(1->4)aDGlc(1->4)bDGlcA(1->3)bDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O140_13

GT NameDonorAcceptorScore / e-value
O112-WfeH


121 / 1e-33
GT nameDonorAcceptorPosition | Link.NumSimilar to
O140_14

bDGlcA(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O38-O038_09


292 / 1e-100
O143-WfdV


286 / 8e-98
O112-WfeI


229 / 9e-76
O30-O030_06


193 / 7e-62
O93-O093_02


189 / 3e-60
O157-WbdN


184 / 2e-58
O91-WbsA


183 / 4e-58
O79-WbdX


179 / 2e-56
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

179 / 2e-56
O27-WejU


177 / 6e-56
O24-WfaM

bDGlc(1->

->3)bDGalNAc

176 / 2e-55
O182-O182_10


175 / 7e-55
O130-WffJ


174 / 1e-54
O81-O081_11


170 / 1e-52
O61-WeiL


169 / 8e-53
O102-WelO

bDGlc(1->

->3)bDGalNAc

169 / 7e-53
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

166 / 3e-51
O165-WcnW


163 / 2e-50
O46-O046_08


160 / 3e-49
O134-O134_08


160 / 2e-49
O21-WclQ


159 / 1e-48
O82-O082_09


141 / 6e-42
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

137 / 3e-40
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

123 / 5e-35
O55-WbgP


107 / 4e-29
O55-WbgP


107 / 4e-29
O128-WbsK

bDGalNAc(1->

->4)aDGal

81 / 6e-20
NMR
1H-NMR5.22 4.17 4.26 3.87 3.76 3.66 3.66 5.32 4.06 3.81 3.42 3.73 1.28 4.45 3.61 3.74 4.22 3.75 3.74 5.41 3.56 3.80 3.64 3.81 3.84 3.84 4.53 3.38 3.74 3.79 3.87 4.64 4.04 3.85 4.11 3.66 3.75 3.79 2.00
Solvent: D2O
Temp: 50C
pD:
Ref: TSP 0 ppm
Comment: - Reference [2]
13C-NMR103.3 77.1 74.3 82.0 71.5 64.3 101.4 80.2 70.7 73.4 70.8 17.7 104.2 71.5 84.3 78.2 76.2 62.4 99.6 72.5 72.7 79.4 71.9 60.8 105.3 74.1 77.2 78.3 77.0 175.4 105.3 52.6 81.4 69.1 76.1 62.5 23.6 175.9
Solvent: D2O
Temp: 50C
pD:
Ref: TSP -1.6 ppm
Comment: - Reference [2]
Enzymes
FlippaseMQCSGSCKARGGSVDNFIYGEALAFNTNLNKNIAYLFLVQGSSYLLPLITFPYLVRVLGP EFFGVLGFCQASMQYLVMLTEYGFNWTATQKIAINKNDRNKLTHIFWGVIFAKILLSFFA FIMLTLVCIFIERYRDVALILAAFSPLVFGNIIYPIWFFQGLEKMKWISLCTITARAMLI PLTFIFVKSPEDVWIAALIQGAINLFAGCISLYIIKRNKWVGRVVFSVKDIKENLVDGWH VFVSTSAISLYTTSTTIILGFVSGPIAVGYFNAANTIRNAAQGLLNPLTQAIYPRINSLF DTNYPQALSLIKKSLRYIGLLSLLGSSFLFILAPYIISLTVGEKYLYSVDILRWMAFLPF VLVLSNIFGVQTMLTHDYKKEFSYILILSGVLNLTIIFPLVYKYSAIGAAISILITESFV ALAMYLFLRIKNIYIIK
Trembl: A0A0A8J6R3
PolymeraseMHRNITLKLILACLTTFVMMLFFPLWLNLLIFTIILFISDNSLKIPVSVILALLSSLFIS SVDIAYDLKNYHDLFVNINSDIYTSEFKFEPFLLYYYSVLSQLDVDFRVVLFLQSLFLNV TLLYVFIKTLGIKGIKYYGLLLIFPQYVQLSLFLSRQTISLLFVVLLITYCLNNKMTLFK FIVVSTIAVSAHAISLLYITIILLSSRLKKYLTWKMLFTIWLVGILMPITADIMNNILQN VFNQIPLLDRKIGFYMNSVSTNISASLTLYSISILPLHILFFMILLSIKKKKYKTTATAF TFVYLIVYYLIIFLINYPLLPARIGLLIIIFTPYFYFVAINVFYSDSKYYKVMENFGVLF VLAIFIRFLFTNDYGDYNVNLANKHILEYSLSNLLN
Trembl: A0A0A6ZE91
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Perepelov AV. " Structure and gene cluster of the O-antigen of Escherichia coli O140". Carbohydrate Research. (2015),