O-Antigen Description

Serogroup:O169
Serotype H:8
Serotype K:-
Strain:
Structure:
 bDGlc(1->6)
          |
   ->3)aDGal(1->6)aDMan(1->2)aDMan(1->3)bDGalNAc(1->
          |
bDGlcA(1->4)
Comment:- Structure [2]
- Strain is given for gene sequence study
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O169_03

bDGlc(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O183-wbaS


621 / 0.0
O76-O076_07


98 / 4e-25
O38-O038_09


94 / 4e-24
O143-WfdV


91 / 9e-23
O165-WcnW


89 / 3e-22
O24-WfaM

bDGlc(1->

->3)bDGalNAc

87 / 1e-21
O46-O046_08


85 / 5e-21
O149-WbuU


84 / 2e-20
O134-O134_08


84 / 1e-20
O82-O082_09


83 / 3e-20
O115-WegI


80 / 5e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O169_04

aDGal(1->

GT NameDonorAcceptorScore / e-value
O183-wbaT


614 / 0.0
O144-O144_03


309 / 3e-105
O81-O081_10


163 / 1e-48
O27-WejX


147 / 2e-42
O29-WffY


140 / 8e-40
O56-WfaQ


134 / 1e-37
O130-WffI


127 / 2e-35
O102-WelN

aDGal(1->

->6)bDGlc

124 / 2e-34
O66-WfaB


122 / 1e-33
O173-WcmX

aDGlc(1->

->2)bDGlc

117 / 8e-32
O18-wcxD


117 / 6e-32
O152-WfgE


114 / 8e-31
O187-O187_10


109 / 5e-29
O24-WfaO

aDGlc(1->

->2)bDGlc

105 / 1e-27
O110-O110_03


101 / 2e-26
O178-O178_05


85 / 1e-20
O153-O153_02


85 / 1e-20
O65-O065_10


83 / 5e-20
O85-WfbQ


83 / 9e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O169_06

GT NameDonorAcceptorScore / e-value
O183-wbaX


565 / 0.0
O175-O175_05


270 / 8e-90
O144-O144_05


265 / 8e-88
O187-O187_12


132 / 5e-37
O88-O088_12


110 / 1e-29
O141-WfcC


92 / 3e-23
O59-WclB


83 / 6e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O169_07

aDMan(1->

GT NameDonorAcceptorScore / e-value
O183-wbaY


612 / 0.0
O175-O175_06


303 / 1e-102
O144-O144_04


172 / 2e-52
O115-WegL

aDMan(1->

->3)bDGlcNAc

152 / 2e-44
O58-WffE


151 / 6e-44
O78-WejO


147 / 2e-42
O187-O187_13


147 / 6e-43
O34-O034_12


139 / 1e-39
O141-WfcD


136 / 1e-38
O88-O088_13


135 / 3e-38
O99-WejK

DRha(1->

->?)?DGlcNAc ->?)?DGalNAc

127 / 4e-35
O60-O060_12


127 / 2e-35
O9-WbdC

aDMan(1->

->2)aDMan ->3)aDMan

103 / 2e-27
GT nameDonorAcceptorPosition | Link.NumSimilar to
O169_14
NMR
1H-NMR4.46 3.27 3.48 3.38 3.42 3.79 3.90 4.94 3.30 3.55 3.53 3.76 4.97 4.04 4.07 4.47 4.15 3.86 4.06 5.06 4.08 3.87 3.95 3.83 3.54 4.17 5.13 4.01 3.84 3.72 3.55 3.75 3.84 4.72 4.04 3.83 4.13 3.64 3.79 3.79 2.02
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR104.7 75.3 77.8 71.8 78.0 62.8 103.9 75.6 77.7 73.9 77.6 176.6 100.4 69.7 81.3 78.3 72.1 71.8 104.3 72.2 73.5 68.1 72.7 67.4 96.7 80.7 72.5 68.4 75.6 63.0 105.3 53.2 77.6 65.7 76.8 63.2 24.6 176.6
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMKEWDLKRNIFTNSLWMILEKAIAILGLIFVTSYVAKYVGTEIFGEIAYATSLFQIVQVV SQLGSDVLIFKRISKNTKSGIKLIQSTIFIRIMIYCILSLLILFYLLKEHSEFSHVYMVA AMLSCFFSAMDVYSIYYDVNLLSKYNTIVNALGLTITLLIRWIIAFYELKPEFLCIPIIL TGLIPFVIRFVLFRINEDSSYIPFKHMKKYIMYMIKAGSTIVISSVSVAIYTRVSVIVLG FFLDKESVGVYSVAASLGMAWSFIPNSFITSSLPSIFSEKDNSKAIVKAANLNLLVFFVC IPFIVGGYLFGFYFIKLLYGDSYIAAYYPMVLLCIATMFAALGTVASRFITHYSGYSFLS KKTILVLFFSLILSCFFVKYHGVTGAAISIVITEVLSLTLFNYLFNKGIVFKLHLKTVGK ALERING
Trembl: A0A0A8J6I4
PolymeraseMIIITSFMVLLFLFTDNLKLKNFRIILFYFFSLCFSVLVYFRPEYMLNTDYKEYYNYFKW INFDNVYKLSDAIGFEYGFGYIVTLIKYFFESERACFSGIAFLSVFISYKAILRLNPKTT AFSFSLFLLSFCVYIFLGQIRQGISLSLGLLAISYLLEDKRKQFLLTVIIASSIHVTALI LILAPFVKYFRIKYIFYSLLISFTFVFIDVIKPLIITLVQFIPFGSFITGKIIAYGNSEF STKVGFSFIQVYYVLLSTVLYILVQKYEYKNNHILILCKIFMVGVILNFTFNSFSVLLRL TYYYLAFDCILLGYLLNMAKNGYTKILIYCPTLMLFILRFYMQWSEHING
Trembl: A0A0A8J914
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • "Structure and genetics of the O-antigen of Escherichia coli O169 related to the O-antigen of Shigella boydii type 6". Carbohydrate Research. (2015),