O-Antigen Description

Serogroup:O12
Serotype H:
Serotype K:
Strain:Bi626-42
Structure:
->2)bDGlc(1->6)aDGlcNAc(1->3)aLFucNAc(1->3)bDGlcNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O012_O2

bDGlc(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O28-O028ab_05


103 / 5e-27
O124-WfeQ


102 / 1e-26
O164-WfeQ


102 / 1e-26
O165-WcnW


92 / 3e-23
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

87 / 1e-21
O46-O046_08


86 / 2e-21
O134-O134_08


86 / 2e-21
O82-O082_09


85 / 5e-21
O124-WfeS


83 / 8e-20
O164-WfeS


83 / 8e-20
O111-WbdL

aDGlc(1->

->4)aDGal

82 / 6e-20
O117-WbeA


82 / 9e-20
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

82 / 6e-20
O160-O160_05


82 / 1e-19
O43-O043_04


82 / 6e-20
O107-WclW


81 / 2e-19
O27-WejU


81 / 1e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O012_05

GT NameDonorAcceptorScore / e-value
O172-Orf5


247 / 1e-80
O25-WekC


135 / 4e-38
O123-WfbF


128 / 2e-35
O186-O186_12


124 / 4e-34
O16-WbbK

aDGlc(1->

->3)aLRha

102 / 9e-27
O109-weiM

aDGlc(1->

->3)aL6dTal

97 / 1e-24
GT nameDonorAcceptorPosition | Link.NumSimilar to
O012_09

aLFucNAc(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O25-WbuB


647 / 0.0
O177-WbuB


642 / 0.0
O4-WbuB

aLFucNAc(1->

->3)bDGlcNAc

639 / 0.0
O172-WbuB

aLFucNAc(1->

->3)aDGlcNAc

635 / 0.0
O26-WbuB

aLFucNAc(1->

->3)bDGlcNAc

619 / 0.0
O151-WbfG


516 / 0.0
O118-WbfG


516 / 0.0
O108-O108_18


516 / 0.0
O29-WbuB


514 / 0.0
O15-WbuB


511 / 0.0
O145-WbuB

aLFucNAm(1->

->3)bDGlcNAc

509 / 0.0
O98-WbwW

aLQuiNAc(1->

->3)bDGlcNAc

450 / 1e-160
O181-O181_07


380 / 3e-133
O123-WbwH


343 / 3e-118
O186-O186_16


335 / 1e-115
O163-O163_11


317 / 2e-108
NMR
1H-NMR4.79 3.88 3.69 3.50 3.44 3.80 3.94 4.99 4.28 3.97 3.88 4.41 1.16 5.01 3.96 3.76 3.77 3.84 3.97 4.08 4.51 3.49 3.49 3.38 3.40 3.71 3.89
Solvent: D2O
Temp: 40C
pD:
Ref: Acetone 0 ppm
Comment: 1H-NMR [2]
13C-NMR102.6 57.1 79.3 69.9 77.1 62.3 98.7 49.7 75.0 72.1 67.8 16.5 99.9 54.7 72.1 72.0 72.8 70.0 103.3 80.8 77.9 71.0 76.9 61.9
Solvent: D2O
Temp: 40C
pD:
Ref: Not Stated -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMNIVLKNSMYLVFMQMCNYAIPLITLPYLTRCLGFYQYGVLNTAINIILYIILVIDFGFN LSATREISQKKNNFVAVSKIFTDVIFAKIILFFGVLVFTFLILKLIPDYQDVTRLVYFML PQVLSSILFPLWLYQGYEKIGYAAFINVLGKCITIPLLLIFVQNSKDVTNAAIILSWSSL VPLLIYYIRSNLPRTKFYTSRCRFKYLNRTLANALVVFIGSIAVNLYTLSTPLVLSIVSD FDQVGYFVAADKIRAAFIGVFLIVGQAIYPRASALYNEDIIAYNKFVISIIFYQIIVCTF SAIAFYYFMPEVAPIILSQNKLNVEELSVIIKLMSPMIILIPLSVILANCVLLPQRKNKQ YALVPIITVIIHMSYSIILCEKLGALGASYAILLTEIISCALLAYFTFKDRLIQLNPAR
Trembl: A0A0A8J3R2
PolymeraseMNHSYIYVYIFFVFLSFFELNDTNRARCDLYYAIQVIVLLLTMGLSYQIGVDWVEYERVY NGNSESLNNYEFGYIVLNNIANYLGASFWGFVILIKYTFFISLFLMVRKFSRLPVLTTTL ILGLLFPFINDPLRQIISASILFFTIYFYNRPPKILGIIGGGVFHSTFIIIIIRYLKIFT KRSIVLIFVFVGVAILLFLKYGSFLGDGMLFRKLNFYMEYSSLSNLYGFALRFLLLSFIV FNIDVYKANCKFIRGDICYYFWIFSITYLWLEIIFVTFPLIPQRMRLYLLPFAFILLSNY LYYSRLTFTKNILAFICVIISFSSLCLFLDGPMGHFYSITDNIVLKYIQGFTNDKTYDAN QFWINGI
Trembl: A0A0A8J2P0
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Senchenkova SN. "Structure and Biosynthesis Gene Cluster of the O-Antigen of Escherichia coli O12". Biochemistry (Mosc). 81. (2016), pp 401-406 PubMed: [27293097]