O-Antigen Description

Serogroup:O37
Serotype H:
Serotype K:
Strain:H510c
Structure:
  ->4)bDGalNAc(1->3)aDGal(1->4)bDGal(1->3)bDGalNAc(1->
         |
DGro(1-P-3)
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O037_11

bDGalNAc(1->

->3)aDGal

GT NameDonorAcceptorScore / e-value
O102-WelM

bDGalNAc(1->

->3)aDGal

189 / 5e-59
O48-O048_06


171 / 2e-52
O130-WffH'


161 / 3e-48
O128-WbsK

bDGalNAc(1->

->4)aDGal

95 / 2e-24
O82-O082_09


89 / 1e-22
O127-WbiP


88 / 4e-22
O90-O090_13


88 / 4e-22
O160-O160_08


86 / 2e-21
O143-WfdT


85 / 7e-21
O125-O125_04


84 / 2e-20
O86-WbnJ

bDGal(1->

->3)aDGalNAc

83 / 3e-20
O86-WcmC

bDGal(1->

->3)aDGalNAc

83 / 2e-20
O23-O023_06


83 / 2e-20
O112-WfeI


82 / 5e-20
O86-WbwJ


81 / 8e-20
O81-O081_11


81 / 8e-20
O5-O05_12


80 / 3e-19
O24-WfaM

bDGlc(1->

->3)bDGalNAc

80 / 2e-19
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

80 / 2e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
O037_13

bDGal(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O5-O05_15


283 / 5e-96
O71-WdaK

bDGal(1->

->3)aDGalNAc

283 / 2e-96
O185-O185_03


268 / 3e-90
O174-WbcZ


261 / 9e-88
O33-O033_09


254 / 8e-85
O178-O178_09


253 / 2e-84
O153-O153_06


253 / 2e-84
O171-O171_13


251 / 8e-84
O112-WfeJ


244 / 3e-81
O160-O160_08


240 / 1e-79
O104-WbwC

bDGal(1->

->3)bDGalNAc

238 / 6e-79
O107-WclZ

bDGal(1->

->3)aDGalNAc

236 / 8e-78
O155-WclG


236 / 8e-78
O117-WbeD

bDGal(1->

->3)aDGalNAc

236 / 7e-78
O146-WbwW


235 / 1e-77
O70-O070_13


210 / 8e-68
O131-O131_11


196 / 1e-62
O7-WbbD

bDGal(1->

->3)aDGlcNAc

170 / 2e-52
O65-O065_13


147 / 7e-44
O28-O028ab_02


116 / 5e-32
O63-WbuP


109 / 1e-29
O64-O064_03


108 / 3e-29
O54-O054_06


102 / 4e-27
O92-O092_07


91 / 5e-23
O74-O074_09


89 / 2e-22
O126-WbsT


88 / 4e-22
O114-WbuP

bDGal(1->

->3)aDGlcNAc

87 / 6e-22
O23-O023_06


84 / 8e-21
O167-WfdH


83 / 2e-20
O127-WbiP


82 / 5e-20
O90-O090_13


82 / 5e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O037_12

GT NameDonorAcceptorScore / e-value
O75-wekY


108 / 8e-29
O48-O048_07


87 / 2e-21
O117-WbeC


87 / 2e-21
O65-O065_12


86 / 6e-21
O107-WclY


84 / 3e-20
NMR
1H-NMR4.71 4.17 3.92 4.11 3.72 3.78 3.78 4.52 3.56 3.68 4.02 3.71 3.82 3.86 4.92 3.89 3.94 4.17 4.34 3.67 3.70 4.67 3.98 4.24 4.27 3.69 3.67 3.70 3.88 3.88 3.89 3.60 3.67
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: - Reference [2]
13C-NMR103.7 52.5 80.7 69.5 76.5 62.2 106.4 71.9 73.4 78.5 75.9 61.4 101.9 69.1 80.3 70.3 71.6 61.8 104.5 53.1 76.0 75.6 75.0 61.8 67.7 72.1 63.5
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: - Reference [2]
Enzymes
FlippaseMFRRIISHRVFKNSFALFIMQLFSYVSPLLVLPYLARIMSVENFGMLMMLYSLLAICLVV TDFGFNLSGTYYISRNYKNKKKINEFLTSVFCIKIILSTASVIFFLVFFRGEFQRLDKYS VLLIAITMFVQSFQPIWFFQGIEKMRHITIYTALSKLIYLLLVFLFVTSDSIVTVLLCYC ISQMVGTFFSICFILKMKYSFSRTTYKNIISVFRQSIPFFVSRVAVVVYTSANTLFLGKY GGMAQAASYSSCEKIYFAGQSLLNPLSQAFFPYLSKNRDAKFYIKFVILSVCILSVICAV ASFFVYDFLNIFYGQKYNDSIGILNTFLITTVIAYTSVSFGYPMYTLIDKIGYVNHTVII GAVIHIIGLFILAKENIFTAQNIAYLVLIVETSVLITRVFLYTYLKIKRV
Trembl: A0A0A8J374
PolymeraseMIRLQNIILFVLLAFSGVYVSSWLIKPSYVAVIISFFILTILTLRGVRYSFSSSIFILIA ICVFYTIFNQFALEGELPTIIFYSCLILIPLLVSTFKSSTSKSNILLVSYIILIIYYSFE TFIRITNPDYSHLPKTGDDGITSTFYIYKINSIAFEDSNFISVILVVYYISLRSTALYSD IKVKYSLGLNIGLLTLILLTFSRSAYIGVLIFECMVLFFFKPDVNMKLRGLLVSIILVGG GICAHFIIEKIASDPSFISKFYIVDLTVKYLSHASTLDILFGIGFGNAINVLGMGAHNIF IAIFIENGLIGTLLYLYILIMLSIRYKLTMLLIIPISIMGLSFSQIAMPYFYVVIAWLIF VNEDRCEKISKCCNAHL
Trembl: A0A0A8J3M1
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Shashkov A. "Structures and genetics of biosynthesis of glycerol 1-phosphate-containing O-polysaccharides of Escherichia coli O28ab, O37 and O100". Carbohydrate Research. (2016), PubMed: [27058293]