O-Antigen Description

Serogroup:O38
Serotype H:
Serotype K:
Strain:F11621-41
Structure:
         aDGlcNAc(1->4)
                     |   
->6)bDGlcNAc(1->3)bDGalNAc(1->4)bDGlcA(1->3)bDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O038_03

GT NameDonorAcceptorScore / e-value
O81-O081_09


111 / 2e-30
O182-O182_09


86 / 2e-21
O170-O170_05


82 / 4e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O038_06

bDGlcNAc(1->

GT NameDonorAcceptorScore / e-value
O18-wekU

bDGlcNAc(1->

->3)aDGal

144 / 2e-42
O142-O142_11


141 / 2e-41
O3-WclU


135 / 3e-39
O23-O023_03


90 / 1e-22
GT nameDonorAcceptorPosition | Link.NumSimilar to
O038_07

GT NameDonorAcceptorScore / e-value
O82-O082_07


198 / 2e-64
O23-O023_05


144 / 8e-44
O124-WfeR


92 / 7e-24
O164-WfeR


91 / 1e-23
GT nameDonorAcceptorPosition | Link.NumSimilar to
O038_09

bDGlcA(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O143-WfdV


301 / 5e-104
O140-O140_14


292 / 1e-100
O112-WfeI


240 / 4e-80
O134-O134_08


197 / 9e-64
O93-O093_02


196 / 5e-63
O46-O046_08


195 / 9e-63
O30-O030_06


191 / 4e-61
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

183 / 5e-58
O91-WbsA


177 / 7e-56
O130-WffJ


172 / 8e-54
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

172 / 1e-53
O182-O182_10


172 / 1e-53
O27-WejU


172 / 1e-53
O21-WclQ


171 / 2e-53
O79-WbdX


166 / 1e-51
O157-WbdN


166 / 3e-51
O82-O082_09


164 / 5e-51
O24-WfaM

bDGlc(1->

->3)bDGalNAc

159 / 8e-49
O165-WcnW


155 / 1e-47
O102-WelO

bDGlc(1->

->3)bDGalNAc

154 / 9e-47
O81-O081_11


153 / 3e-46
O61-WeiL


150 / 2e-45
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

147 / 3e-44
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

110 / 3e-30
O169-O169_03


94 / 3e-24
O183-wbaS


93 / 7e-24
O55-WbgP


88 / 3e-22
O55-WbgP


88 / 3e-22
O128-WbsK

bDGalNAc(1->

->4)aDGal

88 / 3e-22
O32-WfeA


87 / 7e-22
O18-wekT


87 / 5e-22
O34-O034_10


85 / 5e-21
O117-WbeA


84 / 7e-21
O102-WelM

bDGalNAc(1->

->3)aDGal

84 / 1e-20
O107-WclW


82 / 2e-20
O112-WfeF


81 / 9e-20
O113-WbnA


81 / 1e-19
O185-O185_07


80 / 2e-19
Enzymes
FlippaseMKKYLSNLLWLLSDRVFMLVFQLSLFASIKRIYGLDILGSWATIMNISQILLSLFLFGID IVVVKRIVENPSSTGTEIGCALFLQFLGLLLYASAFITIVIYFYYDIPFAFIFVAILIVA NFFSLYAKVIFFHYSALVESKYRAITILSSVAVSYGYLWCCIYFGWHVFYAYVFFYLIQA LFSFTIYKFYFPYSAKWTIDLELVKMYFFMGSKLIVSTISVSLFTQCDVILLESLTGTKE AGAFSAALRLSAIWFMCGGLIANAFFPKIVQLEKIGEEESFIFLKWICGVVSVISIYGAI IMIALSPIIIKILYGDNMDLSAQVLMVHMWSGVFVFLGSFSSKWLFSKNYINLEVIKTII AAILNITLNIIVIPKYGAVGAASVSLLSYFIANFLIFIFIPKTKNMFKMQLQSLKYIIFP WRLINDFGRVRCQFQ
Trembl: A0A0A8J389
PolymeraseMNIYKNSNENSLSNNNCIVYFIPLLLLATFFFPLVVLIFIGALSPLLHPVLRNFYFYALL VFIIIFFSTLKPFGDIAEYLHVYHELNYNLIDVFGYSRFGDGLEFMFLAIMKFIGYISGG NDEVFLLSTYFLIVFFLSKILKDVDKKYKLFLLSLFFFNLGFIEVTSYFLRQVLSVVVFL YAINERSFKKYIFFLLSVFFHMSAVVNVFIYAVYMIFGSKKYSYAKIVFSILIGLLVVFF VVYNTPIYSVLLSKFTSVSGNDKFTRLPLNYIIITVVNICFIIMIGKRSKCDDFNKILFC KECFLFLILLPFPALSNRLGMIIFGFYPYFILPYLKAFERKGKSKYALLICLYVVNLVPF LYLMYNVSLGNNMFTFLNNHPFTEGVYGMIDYILEAIDKGVNYINEGN
Trembl: A0A0A8J4E7
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Knirel YA. "Structural Relationships Between Genetically Closely Related O-Antigens of Escherichia coli and Shigella spp.". Biochemistry (Mosc). 81. (2016), pp 600-608 PubMed: [27301288]