O-Antigen Description

Serogroup:O55
Serotype H:6
Serotype K:
Strain:ICC219
Structure:
Comment:
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbgP

bDGlc(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O55-WbgP


513 / 0.0
O140-O140_14


107 / 4e-29
O102-WelO

bDGlc(1->

->3)bDGalNAc

106 / 8e-29
O165-WcnW


103 / 6e-28
O157-WbdN


102 / 2e-27
O66-WfaC


101 / 5e-27
O24-WfaM

bDGlc(1->

->3)bDGalNAc

101 / 4e-27
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

101 / 4e-27
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

99 / 4e-26
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

97 / 2e-25
O182-O182_10


97 / 2e-25
O112-WfeI


96 / 3e-25
O149-WbuU


92 / 9e-24
O93-O093_02


90 / 5e-23
O130-WffJ


90 / 7e-23
O81-O081_11


89 / 1e-22
O38-O038_09


88 / 3e-22
O130-WffH'


86 / 3e-21
O61-WeiL


85 / 2e-21
O79-WbdX


84 / 6e-21
O134-O134_08


84 / 6e-21
O30-O030_06


83 / 9e-21
O46-O046_08


83 / 9e-21
O160-O160_04


83 / 2e-20
O143-WfdV


81 / 9e-20
O46-O046_05


81 / 7e-20
O134-O134_05


81 / 7e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbgO

bDGal(1->

->3)aDGalNAc

GT NameDonorAcceptorScore / e-value
O55-WbgO


543 / 0.0
O23-O023_06


143 / 2e-42
O126-WbsT


139 / 8e-41
O127-WbiP


137 / 4e-40
O90-O090_13


137 / 4e-40
O86-WbnJ

bDGal(1->

->3)aDGalNAc

135 / 2e-39
O86-WbwJ


135 / 3e-39
O86-WcmC

bDGal(1->

->3)aDGalNAc

135 / 2e-39
O128-WbsK

bDGalNAc(1->

->4)aDGal

134 / 1e-38
O113-WbnA


122 / 6e-34
O74-O074_09


111 / 2e-30
O48-O048_06


108 / 6e-29
O167-WfdH


107 / 9e-29
O125-O125_04


106 / 3e-28
O102-WelM

bDGalNAc(1->

->3)aDGal

101 / 1e-26
O178-O178_09


99 / 5e-26
O153-O153_06


99 / 5e-26
O71-WdaK

bDGal(1->

->3)aDGalNAc

96 / 1e-24
O114-WbuP

bDGal(1->

->3)aDGlcNAc

92 / 2e-23
O54-O054_06


92 / 2e-23
O65-O065_13


91 / 3e-23
O92-O092_07


91 / 3e-23
O114-WbuM


90 / 8e-23
O63-WbuP


89 / 2e-22
O160-O160_08


89 / 1e-22
O64-O064_03


88 / 3e-22
O146-WbwW


87 / 1e-21
O104-WbwC

bDGal(1->

->3)bDGalNAc

84 / 8e-21
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

83 / 1e-20
O70-O070_13


83 / 2e-20
O171-O171_13


81 / 1e-19
O165-WcnW


81 / 8e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbgN

aCol(1->

->2)bDGal

GT NameDonorAcceptorScore / e-value
O55-WbgN

aCol(1->

->2)bDGal

600 / 0.0
O126-WbgL


196 / 9e-62
O128-WbsJ

aLFuc(1->

->2)bDGal

157 / 4e-47
O127-WbiQ


123 / 2e-34
O90-O090_14


123 / 2e-34
O86-WbwK

aLFuc(1->

->2)bDGal

120 / 4e-33
O86-WbnK

aLFuc(1->

->2)bDGal

119 / 5e-33
O86-WcmD

aLFuc(1->

->2)bDGal

119 / 5e-33
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbgM

aDGal(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O55-WbgM

aDGal(1->

->3)bDGalNAc

568 / 0.0
O128-WbsH

aDGal(1->

->3)bDGalNAc

392 / 9e-138
O110-O110_02


330 / 1e-113
O18-wekW


248 / 2e-81
O69-O069_12


244 / 3e-80
O113-WbnE


239 / 4e-78
O3-WclR


225 / 2e-72
O40-WffO


219 / 3e-70
O148-WbbG

aDGlc(1->

->3)aDGlcNAc

150 / 6e-44
O19-O019_11


149 / 1e-43
O51-O051_12


149 / 9e-44
O120-O120_15


135 / 2e-38
O87-WfgO


134 / 7e-38
O22-WbhP


117 / 5e-32
O76-O076_08


107 / 3e-28
O111-WbdM

aCol(1->

->3)aDGlc ->6)aDGlc

101 / 2e-26
O142-O142_03


100 / 9e-26
O86-WbnH


88 / 7e-22
O86-WbwH


88 / 7e-22
O86-WcmA

aDGalNAc(1->

->3)bDGalNAc

88 / 1e-21
O127-WbiN


88 / 7e-22
O90-O090_04


88 / 8e-22
O89-O089_06


87 / 2e-21
O121-WbqH


84 / 2e-20
O101-O101_06


83 / 6e-20
O116-O116_10


82 / 7e-20
Enzymes
FlippaseMIKKMFSSGFIKNGISNYICVAWMGGVSIIVLPYYLHILGPQQWGIVAICISIQSLMYLADAGMSQIMPR DIARCNGKSRELYVIYKSFLHAYSLLAIIVFSLILVGSYFIIDFWLVLDFSLKKEVFICVVLLGLQFLFQ FPNNANIGYWNGTLQQHKSNIRQCFFFTLKHIVAICLVTKWPQAILYQSGFLLIAFLESTSNTIKILFSF DGNIKRQEKLSIGINKIFRESGVLSIAVAIGLLVTQLDRIVLSKYVDISDFGYYVLASTLAQYFLQLQYP LLRLFFPRLTVALNKQNILRLLYSIIIFCVFPCLIMVLISPFFLSLWLDNAEAESIIIWPLRLILIAIAI NSIYNIIYQIMLIKQKAIVILCINISSLLCVFPTIWLLSTRVGVLAGGIGWVLCSLIQLFISLLWLFKRK ESILL
Trembl: B1B4W4
PolymeraseMFNKKYVVIIWGGVLSLLCSLPLSIQGGFDDSLVYYEQAIYIWNNGLLEGLSSIYHQTNKFEIGMGLFFY LQGFLGEGRFVFILLNLFLVNFLAVLIYLKINDEVRISPSLLCVTLMLMSYYVFSNNIYVWRSIICLYFL VLMIYSKTKYKKIIFIGLGLLFHYTFILFLCVYYFCRVNKIGKFKFVIVSIIISFIISNFLYWMSYASLF VSGGELSLFMSQDNEALKRLIISGTFLFLLLMINLESETNNWVLYKLSLFFCILSIFLCDNWQLSWRVFV PAAILGTAIILSNIKKKDSVVLLGITLSIIPTFRLIFNLLILGHP
Trembl: B1B4W5
Literature
  • First Author: Iguchi, A. "Genomic comparison of the O-antigen biosynthesis gene clusters of Escherichia coli O55 strains belonging to three distinct lineages". Microbiology. 154. (2008), pp 559-70 PubMed: [18227260]