O-Antigen Description

Serogroup:O131
Serotype H:
Serotype K:
Strain:S239
Structure:
->8)aNeu5Ac(2->6)bDGal(1->6)bDGal(1->3)bDGalNAc(1->
Comment:- Structure [2]
- Strain is for GT data
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O131_08
GT nameDonorAcceptorPosition | Link.NumSimilar to
O131_10

GT NameDonorAcceptorScore / e-value
O46-O046_07


87 / 8e-22
O134-O134_07


83 / 2e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O131_11

bDGal(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O155-WclG


384 / 7e-136
O104-WbwC

bDGal(1->

->3)bDGalNAc

332 / 8e-116
O71-WdaK

bDGal(1->

->3)aDGalNAc

264 / 5e-89
O33-O033_09


263 / 3e-88
O178-O178_09


260 / 2e-87
O153-O153_06


260 / 2e-87
O174-WbcZ


256 / 8e-86
O171-O171_13


254 / 3e-85
O5-O05_15


246 / 8e-82
O146-WbwW


239 / 2e-79
O160-O160_08


239 / 2e-79
O37-O037_13


229 / 2e-75
O117-WbeD

bDGal(1->

->3)aDGalNAc

227 / 9e-75
O107-WclZ

bDGal(1->

->3)aDGalNAc

226 / 3e-74
O112-WfeJ


220 / 5e-72
O185-O185_03


218 / 8e-71
O70-O070_13


207 / 8e-67
O7-WbbD

bDGal(1->

->3)aDGlcNAc

168 / 1e-51
O65-O065_13


151 / 2e-45
O28-O028ab_02


110 / 3e-30
O64-O064_03


109 / 9e-30
O54-O054_06


102 / 4e-27
O114-WbuP

bDGal(1->

->3)aDGlcNAc

89 / 1e-22
O92-O092_07


89 / 2e-22
O63-WbuP


86 / 1e-21
O74-O074_09


82 / 4e-20
NMR
1H-NMR4.41 3.51 3.62 3.92 3.67 3.76 3.76 4.43 3.52 3.61 3.93 3.83 3.88 4.01 4.64 3.95 3.87 4.15 3.66 3.76 3.76 1.82 2.24 3.99 3.88 4.10 3.68 3.92 3.73 3.83 2.02 2.04
Solvent: D2O
Temp: 40C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR104.8 72.0 74.1 69.9 76.3 62.2 105.9 71.8 73.6 69.9 74.9 70.5 101.8 53.0 81.2 69.2 75.9 62.2 176.0 97.4 40.6 68.6 53.6 71.1 68.4 79.2 62.2 23.4 23.6 176.1 176.1
Solvent: D2O
Temp: 40C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMSVYKNSSIYLISNIFNALIPFILLPILTRNLTPYEYGQIAMFQTLVSGLASLTGLNTVG AANRRYYDITSKSGLAVYNTNCFYILILSCAALLLLSLLLSDLLSSLLTIPNNWVYLSVV ISGATFIIQFRLGQWQIREKAFWFGILQISQSVIVSVLTIIFLICMHQGASSRVNSLFMV SIVYALVSLYSLYKSKLIMLTKINLLDVRDALYFGVPLIPHILGIFCLSALDRVLINGVL GASEAGIYMLAAQLSLGMMVFFDALNKALVPWLFNALSLNDVNKINSLIRFTYLFFIIVA ILGGLSFWIGPLVVELVAGNEYLNAKNIIGWLCLGQAFNGMYLMVTNYLFYAKCTGRLSI VTIFSGGVNIVLLLVLMKFLGITGVAISFSISMFIRFLATWWLAAKVCGFSWRMSIRRII FG
Trembl: A0A0A6ZF35
PolymeraseMGFIKVFNLKNSIVDDRYNLLWLFAGLLVVFVLGVLLFPLAGFFLFFFVAFLIANSSKFK LKRMVFFVLYFMLVMCIIINENSIQRFIYREDDFTTYYNNYLELLNGNYEFLFQFGGGAE IGLPALNYIFSFFIGNPFPYFLQMTYIGMYIVMLYYLVSIDRYFGNRDKSNKLDLLLWAT LFLKITAMLTIERQAVASFFILYAISDIRRKYLWLFIGCLFHLSTPVVYLAVRFVLNTKT NKKVLVSCIALILFVVFSHQLLSVINHILPNDKVGYVLYYINNGDFIKNELVKSIKQVSY VIPLLLLDFAMRLQGYRWKLSSSLQLFVYSMLILSFLPGVPTRIFMPIVFILYGFYYYDF ICLFRIKTRVIIFLIITSFFSVYKFFLPGYYYRYPIANIYPGYYISSFFDKYGYVERYSL PYSSDININNDDKL
Trembl: A0A0A8J5X5
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Perepelov AV. "Structure elucidation and analysis of biosynthesis genes of the O-antigen of Escherichia coli O131 containing N-acetylneuraminic acid". Carbohydrate Research. 436. (2016), pp 41-44 PubMed: [27863302]