O-Antigen Description

Serogroup:O133
Serotype H:
Serotype K:
Strain:N282
Structure:
->3)aLRha(1->2)aLRha(1->2)aLRha(1->4)aDGalA(1->3)aDGlcNAc(1->
                                        |   
                               aDGlc(1->3)
Comment:- Structure [2]
- Strain for structure elucidation was G1272
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O133_07

aLRha(1->

->2)aLRha

->4)aDGalA

1 |
GT NameDonorAcceptorScore / e-value
O146-WbwV


160 / 6e-48
O69-O069_11


157 / 9e-47
O54-O054_10


150 / 2e-44
O147-WfbY


144 / 4e-42
O19-O019_09


143 / 1e-41
O148-WbbQ


141 / 9e-41
O10-O010_09


140 / 2e-40
O129-RfbF


130 / 6e-37
O13-RfbF


130 / 6e-37
O135-RfbF


129 / 1e-36
O19-O019_08


125 / 4e-35
O2-wegQ

aLRha(1->

->3)aLRha
->2)aLRha

122 / 8e-34
O50-O050_12


122 / 8e-34
O120-O120_14


121 / 2e-33
O150-WfgI


114 / 4e-31
O35-WcnY


114 / 3e-31
O71-WdaM

aLRha(1->

->4)bDGal

109 / 2e-29
O148-WbbR


94 / 6e-24
GT nameDonorAcceptorPosition | Link.NumSimilar to
O133_08

aDGalA(1->

->3)aDGlcNAc

2 |
GT NameDonorAcceptorScore / e-value
O158-wcmT


362 / 1e-125
O116-O116_11


339 / 7e-117
O100-O100_11


259 / 8e-86
O10-O010_12


245 / 3e-80
O138-WfaH

aDGalNAcA(1->

->3)bDGlcNAc

168 / 1e-50
O121-WbqI


166 / 9e-50
O101-O101_07


164 / 2e-49
O89-O089_07


164 / 5e-49
O103-WbtG


149 / 2e-43
O52-Orf16


130 / 1e-36
O111-WbdH

aDGal(1->

->3)bDGlcNAc

125 / 6e-35
O40-WffO


95 / 5e-24
O113-WbnE


84 / 3e-20
O3-WclR


83 / 7e-20
NMR
1H-NMR5.03 4.06 3.99 3.77 4.04 3.79 3.81 5.37 4.10 4.07 4.61 4.22 5.62 4.05 3.86 3.41 3.72 1.25 5.30 4.07 3.88 3.44 3.79 1.31 4.97 4.22 3.83 3.53 3.76 1.29 5.15 3.59 3.64 3.44 3.96 3.76 3.83
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR97.9 72.5 74.2 70.7 73.2 61.8 95.6 53.4 80.9 71.6 72.9 61.4 102.1 68.6 77.7 72.3 72.9 175.0 98.9 76.9 72.0 73.4 70.4 17.8 101.1 80.0 71.0 73.4 70.4 17.9 103.4 68.0 76.5 71.6 70.5 17.9
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMNKILKDIPIKSILHLFIVRGSIYLFPFITLPIITRNLGVAHFGILSLFLAAQQYFVMLV EYGFTLTGARDIVRCDNKQDEMKIINEIILCRLLIFLFCTAIIIGAYAFFTEHGYISCYL ILWSTVFCSVFNQTHFFIGKEKTGFIVISTCITRIVSIVIVVLYVKDNRDINIALLAYSI NTALPNILSTFYLNLYLKYKVKIIFCNNEIIDRFKSGYDIFISNVFTSIYSTLTLMYLGT AKGSIETGYYSSADKLKAAAQGILFPVAQAFFPRVSKECGISFYLLWRKSTTILVCFAVA IVASLFIFSNLIYILLLGEQYLSGINIYYILTLSIIPISFGISYAQNLYLTQGQTKLLRK IYFAVSVLHLFHMPILVHFLGAIGAAISVLITESFASLLMFIFRKKCYTWSQA
Trembl: A0A0A8J6K1
PolymeraseMAYLFISLLFVLLFAEIKITQRKFSPTIVLITLWIGVLIVTQIYSSALWQLSVETMWWVF GGVFAFFIGGFWGKLFFKIYGFKNISLQSNGNTLLFAIPFYILMFFFYYFMVRAGANEDQ NWYVGIRKIINYGEPDLFFIMFGYIYYLIYPMLYLEAARYYSSKSFNKKDKYNYHMQLIM CILYAVMSTAKLKLLLVIVPVFFIRSYFKPTSTKLIIVVGTMFLGVFFLSLILLNKIAGD IGVFKIIITSIGNYTFFNLYAFDSLHFKEFLKIKCIDNSNSCSLLPFFEYGDFRTNIYTI MYSFIEYGFFSYSLFLFMVGFIHNAADQIAKKTSNIYAIILSSVLYVPLVFQIMDNQYTA SKYLIYILMFSYVVYFTNVRRLRVM
Trembl: A0A0A8J8J3
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Shashkov AS. "Structure and gene cluster of the O-antigen of Escherichia coli O133". Carbohydrate Research. 430. (2016), pp 82-84 PubMed: [27203746]