O-Antigen Description

Serogroup:O156
Serotype H:
Serotype K:
Strain:E1585-68
Structure:
           ->4)aLFuc(1->6)aDGal(1->3)aLFuc(1->3)bDGlcNAc(1->
                  |
aDGal4,6(R)Pyr(1->3)
Comment:- Structure [2]
- Strain for structure elucidation was G2315
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O156_06

GT NameDonorAcceptorScore / e-value
O41-O041_04


264 / 1e-87
O84-O084_08


114 / 1e-30
GT nameDonorAcceptorPosition | Link.NumSimilar to
O156_08
GT nameDonorAcceptorPosition | Link.NumSimilar to
O156_09

GT NameDonorAcceptorScore / e-value
O159-WfgR


112 / 6e-30
O151-WbhW


99 / 1e-25
O118-WbhW


99 / 1e-25
GT nameDonorAcceptorPosition | Link.NumSimilar to
O156_14

GT NameDonorAcceptorScore / e-value
O168-WfeY


508 / 0.0
O84-O084_13


483 / 0.0
O159-WfgS


482 / 0.0
O41-O041_12


472 / 0.0
O36-O036_15


465 / 0.0
O125-O125_13


262 / 1e-88
O184-O184_15


262 / 7e-89
O11-WdaG


261 / 1e-88
O43-O043_13


257 / 8e-87
O11-WdaD


125 / 6e-36
O43-O043_04


110 / 2e-30
O173-WcmU

aLFuc(->

->4)aDGlc

108 / 1e-29
O168-WfeV


103 / 6e-28
O111-WbdL

aDGlc(1->

->4)aDGal

101 / 1e-26
O36-O036_08


95 / 1e-24
O41-O041_06


84 / 4e-21
NMR
1H-NMR4.63 3.84 3.69 3.52 3.39 3.67 3.87 5.02 3.91 3.90 3.95 4.33 1.17 5.19 3.83 3.94 4.05 4.25 3.57 3.85 4.88 4.02 3.96 4.03 4.06 1.24 5.32 3.91 4.02 4.26 3.96 3.90 4.04 2.01 1.50 2.04
Solvent: D2O
Temp: 40C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR102.1 57.1 81.3 70.0 77.5 62.3 100.7 68.4 79.7 72.9 68.1 16.6 101.8 69.9.0 70.5 70.5 70.7 67.6 99.8 69.3 75.4 78.9 68.3 17.1 26.3 100.9 175.7 23.5 175.7 23.6 175.5
Solvent: D2O
Temp: 40C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Non-Sugar Components
- Pyruvic acid
Enzymes
FlippaseMQQLAELGLGQTLRLHIAHAFKMDESGWCFNSKKEIKQYYSLSVKWFLVVALCTIIIIGP AGIYYYHSYQGDIIWEGPWVSLVLVTALTIIITPIQITIESLQHQISVFKAQTYASIINS ISLCLLLFSGFGLYAIALSLFISNLTVLIFLWGKIKWLRNNLMPVLVDTNFFVVFKEIWP LFSRVAVVSVFGFLFWNGFNLIAFKVYEPSYAGQVILSITLARAGYGFSESILYGQITYI SNLISNKKYNEAMIVYKKNTYIALTILLIGYVFFLLLMYLFPEFYLFKKIVGSSYLISIF VFFIILLFLTSGNNYVRCFKTEPFVKVSIFHGVMVPTLFYLSSVFYEGYYLYPCSLVLIV SLILSKRISNKYFRMSGIN
Trembl: A0A0A8J8V2
PolymeraseMENQHVYFYKKSNKANVSIVALIFTYISIIGWSPFFSGYLAVPLFLTYHIPFLLLLAYFM LTQKISSALISLSIIMIILISALTLLTESLINFNRYIFEPLTFLLCYYCTVSRKLAEKIC TYASCVVIIGIVLSVISFCYAYAGGNEILTFHNVDGRLNSLYLTSFSNFKIGNIIRPSFI YDEPGAFSFVICFVVILREVLGRKYNWVYLLGGMITLSLTQFIILSLYIIVKNWKNIKQI LVLCFALFGLIMFTYNNNEFDFFYNRFNTENGTFSGDNRSMQISNYLNVVNENMFLLGDY KCHDNINQRCESHGDISSSIVTPIYKGGILQLLLQIITHAIIFWLALRERKLIFPALVLT ILLLQRPFFDVVGYSVMIYYSIFLMFNFKVFKDDYYHSRKK
Trembl: A0A0A8J703
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Duan Z. "Structure and gene cluster of the O-antigen of Escherichia coli O156 containing a pyruvic acid acetal". Carbohydrate Research. 430. (2016), pp 24-28 PubMed: [27177202 ]