O-Antigen Description

Serogroup:O100
Serotype H:
Serotype K:
Strain:H509a
Structure:
  ->2)aLRha(1->3)aLRha(1->3)aDGal(1->3)bDGlcNAc(1->
         |
DGro(1-P-6)
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O100_10

aLRha(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O10-O010_11


328 / 1e-112
O154-O154_14


176 / 8e-54
O97-O097_05


130 / 1e-36
O34-O034_10


98 / 3e-25
O18-wekT


96 / 2e-24
O49-O049_13


93 / 1e-23
O142-O142_10


92 / 4e-23
O129-RfbG


91 / 7e-23
O135-RfbG


91 / 7e-23
O13-RfbG

aLRha(1->

->3)bDGlcNAc

91 / 7e-23
O150-WfgK


90 / 2e-22
O4-WbuG

aLRha(1->

->6)aDGlc

89 / 3e-22
O107-WclX

aLRha(1->

->4)aDGlcNAc

88 / 1e-21
O117-WbeB

aLRha(1->

->4)aDGlc

88 / 1e-21
O154-O154_12


87 / 1e-21
O180-wfcT


86 / 3e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
O100_11

aDGal(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O10-O010_12


384 / 1e-134
O133-O133_08

aDGalA(1->

->3)aDGlcNAc

259 / 8e-86
O158-wcmT


255 / 7e-84
O116-O116_11


237 / 3e-77
O101-O101_07


175 / 2e-53
O89-O089_07


169 / 5e-51
O121-WbqI


168 / 9e-51
O138-WfaH

aDGalNAcA(1->

->3)bDGlcNAc

155 / 7e-46
O103-WbtG


150 / 6e-44
O111-WbdH

aDGal(1->

->3)bDGlcNAc

148 / 3e-43
O52-Orf16


139 / 7e-40
NMR
1H-NMR4.76 3.88 3.77 3.73 3.46 3.75 3.86 5.43 3.95 3.84 4.07 3.73 3.73 3.73 5.00 4.16 3.92 3.58 3.85 1.28 5.20 4.33 4.35 3.40 3.85 1.28 3.91 4.00 3.91 3.61 3.67
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR103.8 55.3 80.5 71.8 76.4 61.5 100.3 69.0 78.1 70.0 72.0 61.5 103.2 71.1 79.4 72.6 70.3 17.9 102.3 78.7 76.2 72.6 70.3 17.9 72.0 63.4
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: 13C-NMR [2]
Non-Sugar Components
- Glycerol
Enzymes
FlippaseMPKKNVVENIIFLSIIQFANYLAPLMVLPFLSRTLGVEGFGLIMVAFSACTLCFLLTDFG FNLSAPYWIARNSNYRNRVSRTIGAIFLIKFIILLIIGLILFLYVLFLTSNTMHMRLMYT IIYCIAIAQAFQPVWFFQGVEKMKNVTIFMVTAKLSYLILIFLFVRNKEDDLLVLLCFFI SNFIATIIGVGLIWGAGYKIMIPTKKIIADTFKASSSFFLSRLAVGVYTNASTLIVGAAS GVVQAGLYSSAEKLYQAGQNLTSPISQALYPYVARTGNKNILFKTILLLLIPMILGCSIC FIYAAEIIKLIYGASFVNAQHVLRIFLIISIITFVSINLGYPAFAAMGRVNLANYTVMLG GIVQVLLLAILYTINSINAVNVALSVLTTEIIVLAVRILLLIKPNINTHEEYR
Trembl: A0A0B0YZU2
PolymeraseMAFIRFVNFLIIFFISIDMGGELGIRNVSFLLLVLLIAYYIVTCKKIKFRLPYVLLIILF LGYPVASLFIGMSNNFDADTGISQISIFVFAFLYFLKRIIEEDNNLPLMPIQYFNNAMLI ISLFYVLMLISYQFFPSIFNSIALYIHDRGAGFAGVRTENGVGFANIYLKSSLFLIFTYC CFLKRNTIKAAIIILATVITTSKALLLTEVLLLVTKLKGRLISVVVFVSALLLFIAIYFD EIMVVFNYMNETLQGNSETYLVRVHHFEDLVALFSENPINFLFGFGAGSSFFSSYYGKYI FNIELDHLNAIRKFGLIWFLSFMWLVFFNIIQLVRLKRNELALGLFLSFVLAGTNPVLLS PIFFILLIECHLLTLKVPCSTSGLHNSKV
Trembl: A0A0A8J5E3
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Shashkov A. "Structures and genetics of biosynthesis of glycerol 1-phosphate-containing O-polysaccharides of Escherichia coli O28ab, O37 and O100". Carbohydrate Research. (2016), PubMed: [27058293]