O-Antigen Description

Serogroup:O28 ab
Serotype H:
Serotype K:
Strain:K1a
Structure:
->3)bDGlc(1->3)DGro(1-P-4)bDGlcNAc(1->3)aDGlcNAc(1->
Comment:- Structure [2]
- Strain is given for the GT study
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
O028ab_02

->3)aDGlcNAc

GT NameDonorAcceptorScore / e-value
O178-O178_09


137 / 8e-40
O153-O153_06


137 / 8e-40
O5-O05_15


135 / 5e-39
O171-O171_13


135 / 2e-39
O174-WbcZ


130 / 2e-37
O117-WbeD

bDGal(1->

->3)aDGalNAc

128 / 2e-36
O107-WclZ

bDGal(1->

->3)aDGalNAc

127 / 3e-36
O104-WbwC

bDGal(1->

->3)bDGalNAc

127 / 5e-36
O65-O065_13


123 / 1e-34
O71-WdaK

bDGal(1->

->3)aDGalNAc

122 / 3e-34
O185-O185_03


120 / 2e-33
O33-O033_09


120 / 1e-33
O63-WbuP


116 / 4e-32
O112-WfeJ


116 / 3e-32
O160-O160_08


116 / 3e-32
O37-O037_13


116 / 5e-32
O146-WbwW


115 / 6e-32
O7-WbbD

bDGal(1->

->3)aDGlcNAc

112 / 2e-30
O70-O070_13


111 / 2e-30
O155-WclG


108 / 4e-29
O131-O131_11


101 / 6e-27
O54-O054_06


89 / 2e-22
O64-O064_03


88 / 5e-22
O167-WfdH


83 / 3e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
O028ab_05

GT NameDonorAcceptorScore / e-value
O12-O012_O2


103 / 5e-27
O160-O160_04


91 / 6e-23
O124-WfeS


90 / 2e-22
O164-WfeS


90 / 2e-22
O112-WfeI


89 / 2e-22
O117-WbeA


82 / 5e-20
O171-O171_11


81 / 3e-19
NMR
1H-NMR5.16 3.99 3.91 3.60 4.05 3.80 3.83 4.59 3.73 3.78 3.97 3.55 3.81 3.90 3.95 3.99 4.05 3.71 4.01 4.48 3.38 3.57 3.59 3.43 3.72 3.90
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0 ppm
Comment: - Reference [2]
13C-NMR99.2 54.2 80.3 69.5 72.7 61.5 102.5 56.9 73.8 75.5 76.2 61.8 67.8 70.7 72.1 104.2 73.3 83.6 71.4 77.1 61.8
Solvent: D2O
Temp: 30C
pD:
Ref: TSP -1.6 ppm
Comment: - Reference [2]
Non-Sugar Components
- Phosphate
Enzymes
FlippaseMIGLKKNIIFMLIYQIVNYLVPLALTPYLVRILGPSSYGELNYSISIVLYICLFVDFGFT LSATKRITKYIGNSDKISKLFYTVTVAKTFLLITGITILILSISTLDTINSVKTIIVISA IQIIATVISPLWLFNGLQLTAVFAVFNIIFKVASIPLVFFLVKTPTDVGYAAFFQTAPLF FSSILALIYLYKKKILIYTNYTPRFKLIIRTLNSSLFYYIGTMSVSLYTMSTPIILGLVS TSEQVGFYSASDKIRAAVVGVYVVIGNVIYPRVQRFYHEDDNLGFQYVKKIIIAVIPLCT IASIMLFYISPFITKYFLGEEFGESELILKIMSPMMFLIPLSIILSNYILLGMGHKKIFS RIPMITATIHIIVATILSLKFGSIGASIAILISEIVSFILLFITCCKLGYIKKLCVLKI
Trembl: A0A0B0V6F4
PolymeraseMSIGILVLVFYVIVNFVMGIVFFNDGFLGGDFYGEKIDNKDLFLWVLGGELLLLITFYAI AVLIVKFTFNKRYPEDYYTVSELALKRFNIFLIVLQTSFILFIFATGFGRISLLMDENSS AANINSPIKYIFVILLPDFLFIVYFLVQKNNKKTIVNLSLYLISNIVRGWVSGPVLLIMA IFLVKKFSFKKIKIKTIISLVTCFIIFVPLVTSLKFGVRFQNDEISAVDLVQDSIENNVS YYLRTLNRFQHISEAYSFMDSMTFIRKDYADNRIALPFFTNDFINITSKIFSFEPQNLLT YGSKVLLDRPFGNIQSGILPWLSIDYFFSISYILTFFIFTILLSRFCKMLTLGYPVSKNI VIWFTIYYYAHGWLFSYMNLLIAMMIFIIFSKVFGGKILNKDNNYA
Trembl: A0A0A8J443
Literature
  • First Author: Iguchi A. "A complete view of the genetic diversity of the Escherichia coli O-antigen biosynthesis gene cluster". DNA Research. 22(1). (2015), pp 101-7 PubMed: [25428893]
  • First Author: Shashkov A. "Structures and genetics of biosynthesis of glycerol 1-phosphate-containing O-polysaccharides of Escherichia coli O28ab, O37 and O100". Carbohydrate Research. (2016), PubMed: [27058293]