O-Antigen Description

Serogroup:O129
Serotype H:
Serotype K:
Strain:G1096
Structure:
               aDGlc(1->3)
                        |
->2)aLRha3Ac4Ac(1->2)aLRha(1->3)aLRha(1->3)bDGlcNAc(1->
Comment:- Structure [2]
- aLRha is 3,4-O-acetylated in non-stoichiometrical amounts
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
RfbF

aLRha(1->

GT NameDonorAcceptorScore / e-value
O13-RfbF


607 / 0.0
O135-RfbF


606 / 0.0
O150-WfgI


250 / 1e-82
O19-O019_08


191 / 4e-60
O69-O069_11


175 / 9e-54
O19-O019_09


172 / 1e-52
O120-O120_14


167 / 1e-50
O10-O010_09


155 / 5e-46
O35-WcnY


146 / 5e-43
O146-WbwV


134 / 2e-38
O2-wegQ

aLRha(1->

->3)aLRha
->2)aLRha

133 / 5e-38
O50-O050_12


133 / 5e-38
O148-WbbQ


130 / 5e-37
O133-O133_07

aLRha(1->

->2)aLRha
->4)aDGalA

130 / 7e-37
O147-WfbY


125 / 3e-35
O54-O054_10


125 / 3e-35
O71-WdaM

aLRha(1->

->4)bDGal

113 / 1e-30
O139-WfaI


106 / 2e-28
O177-WbdY


89 / 3e-22
O148-WbbR


85 / 5e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
RfbG

aLRha(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O135-RfbG


617 / 0.0
O13-RfbG

aLRha(1->

->3)bDGlcNAc

617 / 0.0
O154-O154_12


298 / 2e-101
O105-WbsY


290 / 2e-98
O49-O049_13


287 / 5e-97
O150-WfgK


286 / 6e-97
O10-O010_11


107 / 2e-28
O97-O097_05


105 / 6e-28
O154-O154_14


94 / 4e-24
O180-wfcT


91 / 5e-23
O100-O100_10


90 / 2e-22
O18-wekT


87 / 1e-21
O142-O142_10


84 / 1e-20
NMR
1H-NMR5.13 4.16 3.89 3.33 3.68 1.25 5.22 4.27 4.00 3.61 3.79 1.34 4.86 3.85 3.79 3.55 4.02 1.24 4.77 3.83 3.63 3.48 3.48 3.73 3.95 2.07 5.09 3.60 3.79 3.45 3.93 3.77 3.84
Solvent: D2O
Temp: 40C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2] Chemical shifts are given for the deacetylated structure
13C-NMR102.20 79.60 71.10 73.60 70.50 17.70 101.80 75.60 74.80 71.60 70.30 18.00 102.40 71.80 78.30 72.90 70.20 17.50 103.10 56.90 82.70 69.70 77.20 62.20 23.50 175.40 95.70 72.30 74.20 70.80 72.90 61.80
Solvent: D2O
Temp: 40C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2] Chemical shifts are given for the deactylated structure
Non-Sugar Components
- Acetate
Enzymes
FlippaseMSIIKNSVWNLFGYAIPTLIAIPSLGFLARGLGPEGFGVYTIAIALVGYAGIFDVGLTRSVIREIAIHRD NHHERTKVISTSTSFLVLFSCFGAFLLLIFSDGIVNYLKISGVEHSDIQLAFKLLAICIPLFILNQLWSA ILEGDEKFGIVNIQKSISSSCIAGIPAIFVFYSATLSAAVAGLIFARVISILVSAYYVRNDIKISGVHFC YKTFKRLFFFGGWMTVSNIISPVMVYFDRFIVSNIMGADKVAFYSAPAEVILKLGIIPAAIGRAVFPRLS NIKDFKEFKRNVNKSLLLMFLICLPVIIIGLLYSGLVLKIWFGENYQISSFNILNVLLIGFFFNALAMIP FSAIQALGKSKITALIHCAELVPYLALLYFMVEKYGLLGAAISWSIRVILDALLLQWLYTRMCSVYEN
Trembl: B5L494
PolymeraseMNNINKIFITFLCIELIIGGGGRLLEPLGIFPLRYLLFVFSFILLIFNLVTFNFSITQKCVSLFIWLLLF PFYGFFVGLLAGNKINDILFDVQPYLFMLSLIYLFTLRYTLKLFLCEIFIKIVNAFALYGSLLYISYIIL LNFGLLNFNLIYEHLSLTSEFFFRPDGAFFSKSSYFFGAGAIISFVNKKYLKWLLIVLAILLTESRGVLL FTTLSLLLASFKLHKLYLNTIIIILGSVLFIIMLYMVGSRSEDSDSVRFNDLYFYYKNVDLATFLFGRGF GSFILDRLRIGIVPLEILQKTGVIGVYGSLVPMLLIFVKGYFLNSTKTSLMMSLILFFSITVSITNPFLF TPMGIFIIGVVVLWVFSIENIQISNNLTSGAK
Trembl: B5L497
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov AV. "Structures of the O-antigens of Escherichia coli O13, O129, and O135 related to the O-antigens of Shigella flexneri". Carbohydrate Research. 345(11. (2010), pp 1594-9 PubMed: [20546712]