O-Antigen Description

Serogroup:O79
Serotype H:
Serotype K:
Strain:G4218
Structure:
         aLRha(1->3)
                  |   
->2)bDGal(1->4)bDMan6Ac(1->3)bDMan(1->4)bDGlcA(1->3)aDGlcNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbdT
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbdU
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbdV
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbdW
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbdX

bDGlcA(1->

GT NameDonorAcceptorScore / e-value
O93-O093_02


262 / 9e-89
O182-O182_10


258 / 3e-87
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

256 / 3e-86
O30-O030_06


247 / 5e-83
O91-WbsA


236 / 1e-78
O140-O140_14


182 / 1e-57
O143-WfdV


178 / 9e-56
O38-O038_09


170 / 5e-53
O112-WfeI


152 / 3e-46
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

145 / 2e-43
O81-O081_11


142 / 6e-42
O165-WcnW


139 / 5e-41
O82-O082_09


135 / 1e-39
O46-O046_08


124 / 2e-35
O134-O134_08


122 / 9e-35
O102-WelO

bDGlc(1->

->3)bDGalNAc

121 / 2e-34
O27-WejU


120 / 7e-34
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

117 / 9e-33
O130-WffJ


114 / 1e-31
O157-WbdN


114 / 7e-32
O24-WfaM

bDGlc(1->

->3)bDGalNAc

112 / 5e-31
O61-WeiL


106 / 7e-29
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

96 / 4e-25
O21-WclQ


95 / 9e-25
O55-WbgP


84 / 6e-21
O55-WbgP


84 / 5e-21
Non-Sugar Components
- Acetate
Enzymes
FlippaseMRAGAIVFLRNLLIAVSGFILVSKGVKNLSEADTAFLLLVMLVINAQNALYEGLFLVHTMSFKDKCARTI LKRQNKIQVLIPVLAIIFVLIYSNTVLDISIGYGYVALLYFCFYGNILSISVVNVFCSIRGFTWCFILDI VFTTAFIILSVTYSSRIILILALLLRVGGSAFAGLIFQVRYKKSNDKKLLSLPLYSMGYFSGTLLSLFRD TLSPLLIGWFVGPSILIAIRIFNTCYSAPGLFASALNKIIVRYARKKQSAKKVFITYLIGLYVLSIGYLL IWYIGGERLYLLLFGKTQYFPQTIFLYSISLFCLFWPLGQTAITGMIFTGSSRLFFIVSIIWTFVSAICI FILFIYGIEFYMLAIAFSQMLNILIVYLVRKNETII
Trembl: B5L371
PolymeraseMRVFLYVLILYLSVWITNEYSILSFPIEFNFLYPLPQILLLSFVYAFITRAKKKSHQVDILEWVIPITKL SIVLSLIVLIITLPANGRDAKLEIISNNIVLYYLNMFNSSMLIVMLSSMFQPCRSIVNKKVFFYIIFAII AFSLTNLSRSMAFYFIIAICMSGLKFDIEKKKIISWGMVLIVVMILMPIFQGRTDNVEGALARSILNIVF YVSYSFGLGEYLIKETHLSGISWGYFGYVLSKILNEPLTFNIFFDNKYLYEFIQLGKSDIYGLLNANVMY PLWATVYADFGLFSFIPYLFTFFIIVTSYFMRAYILFSWLFFRFAILGFLVSPVLFRDIVFEIVVVVAFE IFIRKNKRICVDE
Trembl: B5L369
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Knirel YA. "Structural Relationships Between Genetically Closely Related O-Antigens of Escherichia coli and Shigella spp.". Biochemistry (Mosc). 81. (2016), pp 600-608 PubMed: [27301288]