O-Antigen Description

Serogroup:O135
Serotype H:
Serotype K:
Strain:
Structure:
                                  aDGlc(1->6)
                                           |
->2)aLRha(1->2)aLRha(1->3)aLRha2Ac(1->3)bDGlcNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
RfbF

aLRha(1->

GT NameDonorAcceptorScore / e-value
O129-RfbF


606 / 0.0
O13-RfbF


606 / 0.0
O150-WfgI


250 / 8e-83
O19-O019_08


191 / 7e-60
O69-O069_11


175 / 1e-53
O19-O019_09


171 / 2e-52
O120-O120_14


167 / 8e-51
O10-O010_09


155 / 4e-46
O35-WcnY


146 / 6e-43
O146-WbwV


134 / 2e-38
O2-wegQ

aLRha(1->

->3)aLRha
->2)aLRha

134 / 3e-38
O50-O050_12


134 / 3e-38
O148-WbbQ


131 / 4e-37
O133-O133_07

aLRha(1->

->2)aLRha
->4)aDGalA

129 / 1e-36
O147-WfbY


125 / 4e-35
O54-O054_10


125 / 4e-35
O71-WdaM

aLRha(1->

->4)bDGal

112 / 1e-30
O139-WfaI


106 / 2e-28
O177-WbdY


89 / 2e-22
O148-WbbR


85 / 7e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
RfbG

aLRha(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O129-RfbG


617 / 0.0
O13-RfbG

aLRha(1->

->3)bDGlcNAc

617 / 0.0
O154-O154_12


298 / 2e-101
O105-WbsY


290 / 2e-98
O49-O049_13


287 / 5e-97
O150-WfgK


286 / 6e-97
O10-O010_11


107 / 2e-28
O97-O097_05


105 / 6e-28
O154-O154_14


94 / 4e-24
O180-wfcT


91 / 5e-23
O100-O100_10


90 / 2e-22
O18-wekT


87 / 1e-21
O142-O142_10


84 / 1e-20
NMR
1H-NMR5.09 4.13 3.86 3.30 3.66 1.23 5.09 4.02 3.74 3.44 3.57 1.27 4.91 5.01 3.94 3.59 4.07 1.26 2.17 4.74 3.86 3.62 3.67 3.62 3.78 3.96 2.05 4.97 3.55 3.74 3.41 3.71 3.76 3.86
Solvent: D2O
Temp: 40C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
13C-NMR102.40 80.00 71.10 73.60 69.60 18.00 102.40 79.30 71.30 73.30 70.70 17.70 99.70 73.60 77.50 73.00 70.40 17.90 21.60 174.30 103.60 56.90 83.20 70.70 75.70 67.20 23.80 175.90 99.50 72.90 74.50 71.00 73.30 62.00
Solvent: D2O
Temp: 40C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Non-Sugar Components
- Acetate
Enzymes
FlippaseMSIIKNSVWNLFGYAIPTLIAIPSLGFLARGLGPEGFGVYTIAIALVGYAGIFDVGLTRSVIREIAIHRD NHHERTKVISTSTSFLVLFSCFGAFLLLIFSDGIVNYLKISGVEHSDIQLSFKLLAICIPLFILNQLWSA ILEGDEKFGIVNIQKSISSSCIAGIPAIFVFYSATLSAAVAGLIFARVISILVSAYYVRNDIKISGVHFC YKTFKRLFFFGGWMTVSNIISPVMVYFDRFIVSNIMGADKVAFYSAPAEVILKLGIIPAAIGRAVFPRLS NIKDFKEFKRNVNKSLLLMFLICLPVIIIGLLYSGLVLKIWFGENYQINSFNILNVLLIGFIFNALAMIP FSAIQALGKSKITALIHCAELVPYLALLYFMVEKYGLLGAAISWSIRVILDALLLQWLYTRMCSVYEN
Trembl: B5L486
PolymeraseMNNINKIFITFLCIELIIGGGGRLLEPLGIFPLRYLLFVFSFILLIFNLVTFNFSITQKCVSLFIWLLLF PFYGFFVGLLAGNKINDILFDVQPYLFMLSLIYLFTLRYTLKLFLCEIFIKIVNAFALYGSLLYISYIIL LNFGLLNFNLIYEHLSLTSEFFFRPDGAFFSKSFYFFGVGAIISFVDKKYLKCLIIVLAILLTESRGVLL FTTLSLLLASFKLHKLYLNTIIIILGSVLFIIMLYMVGSRSEDSDSVRFNDLYFYYKNVDLATFLFGRGF GSFILDRLRIEIVPLEILQKTGVIGVFISLVPMLLIFVKGYFLNSTKTSLMMSLILFFSITVSITNPFLF TPMGIFIIGVVVLWVFSIENIQISNNLTSGAK
Trembl: B5L481
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov AV. "Structures of the O-antigens of Escherichia coli O13, O129, and O135 related to the O-antigens of Shigella flexneri". Carbohydrate Research. 345(11. (2010), pp 1594-9 PubMed: [20546712]