O-Antigen Description

Serogroup:O13
Serotype H:
Serotype K:
Strain:
Structure:
                    aDGlc(1->2)
                             |
->2)aLRha(1->2)aLRha(1->3)aLRha(1->3)bDGlcNAc(1->
Comment:- Structure [3]
- bDGlcNAc is ~60% O-acetylated at position 6
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
RfbF

aLRha(1->

GT NameDonorAcceptorScore / e-value
O129-RfbF


607 / 0.0
O135-RfbF


606 / 0.0
O150-WfgI


250 / 1e-82
O19-O019_08


191 / 4e-60
O69-O069_11


175 / 9e-54
O19-O019_09


172 / 1e-52
O120-O120_14


167 / 1e-50
O10-O010_09


155 / 5e-46
O35-WcnY


146 / 5e-43
O146-WbwV


134 / 2e-38
O2-wegQ

aLRha(1->

->3)aLRha
->2)aLRha

133 / 5e-38
O50-O050_12


133 / 5e-38
O148-WbbQ


130 / 5e-37
O133-O133_07

aLRha(1->

->2)aLRha
->4)aDGalA

130 / 7e-37
O147-WfbY


125 / 3e-35
O54-O054_10


125 / 3e-35
O71-WdaM

aLRha(1->

->4)bDGal

113 / 1e-30
O139-WfaI


106 / 2e-28
O177-WbdY


89 / 3e-22
O148-WbbR


85 / 5e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
RfbG

aLRha(1->

->3)bDGlcNAc

2 | 1
GT NameDonorAcceptorScore / e-value
O129-RfbG


617 / 0.0
O135-RfbG


617 / 0.0
O154-O154_12


298 / 2e-101
O105-WbsY


290 / 2e-98
O49-O049_13


287 / 5e-97
O150-WfgK


286 / 6e-97
O10-O010_11


107 / 2e-28
O97-O097_05


105 / 6e-28
O154-O154_14


94 / 4e-24
O180-wfcT


91 / 5e-23
O100-O100_10


90 / 2e-22
O18-wekT


87 / 1e-21
O142-O142_10


84 / 1e-20
NMR
1H-NMR5.14 4.15 3.88 3.32 3.67 1.25 5.27 4.05 3.82 3.49 3.69 1.33 5.05 3.86 3.96 3.71 4.02 1.26 4.73 3.84 3.65 3.55 3.46 3.76 3.91 2.08 4.92 3.54 3.78 3.52 3.83 3.82 3.85
Solvent: D2O
Temp: 40C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [3]
13C-NMR102.50 80.10 71.20 73.70 70.60 18.10 101.80 79.30 71.50 73.50 70.60 18.10 99.20 77.30 75.80 73.70 70.90 17.60 103.60 57.10 83.00 69.70 77.30 62.20 23.90 175.80 98.70 72.80 74.10 70.70 73.50 61.90
Solvent: D2O
Temp: 40C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [3]
Non-Sugar Components
- Acetate
Enzymes
FlippaseMSIIKNSVWNLFGYAIPTLIAIPSLGFLARGLGPEGFGVYTIAIALVGYAGIFDVGLTRSVIREIAIHRD NHHERTKVISTSTSFLVLFSCFGAFLLLIFSDGIVNYLKISGVEHSDIQLAFKLLAICIPLFILNQLWSA ILEGDEKFGIVNIQKSISSSCIAGIPAIFVFYSATLSAAVAGLIFARVISILVSAYYVRNDIKISGVHFC YKTFKRLFFFGGWMTVSNIISPVMVYFDRFIVSNIMGADKVAFYSAPAEVILKLGIIPAAIGRAVFPRLS NIKDFKEFKRNVNKSLLLMFLICLPVIIIGLLYSGLVLKIWFGENYQINSFNILNVLLIGFFFNALAMIP FSAIQALGKSKITALIHCAELVPYLALLYFMVEKYGLLGAAISWSIRVILDALLLQWLYTRMCSVYEN
Trembl: B5L478
PolymeraseMNNINKIFITFLCIELIIGGGGRLLEPLGIFPLRYLLFVFSFILLIFNLVTFNFSITQKCVSLFIWLLLF PFYGFFVGLLAGNKINDILFDVQPYLFMLSLIYLFTLRYTLKLFLCEIFIKIVNAFALYGSLLYISYIIL LNFGLLNFNLIYEHLSLTSEFFFRPDGAFFSKSFYFFGVGAIISFVDKKYLKCLIIVLAILLTESRGVLL FTTLSLLLASFKLHKLYLNTIIIILGSVLFIIMLYMVGSRSEDSDSVRFNDLYFYYKNVDLATFLFGRGF GSFILDRLRIEIVPLEILQKTGVIGVFISLVPMLLIFVKGYFLNSTKTSLMMSLILFFSITVSITNPFLF TPMGIFIIGVVVLWVFSIENIQISNNLTSGAK
Trembl: B5L481
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • "Edwards and Ewings Identification of Enterobacteriacae 4th Ed.". Not specified. (1986), pp 135-172
  • First Author: Perepelov AV. "Structures of the O-antigens of Escherichia coli O13, O129, and O135 related to the O-antigens of Shigella flexneri". Carbohydrate Research. 345(11. (2010), pp 1594-9 PubMed: [20546712]