O-Antigen Description

Serogroup:O63
Serotype H:6
Serotype K:
Strain:05-3711
Structure:
Comment:
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuL-like protein

GT NameDonorAcceptorScore / e-value
O114-WbuL


86 / 4e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
Hypothetical protein
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuP

bDGal(1->

->3)aDGlcNAc

GT NameDonorAcceptorScore / e-value
O114-WbuP

bDGal(1->

->3)aDGlcNAc

317 / 1e-109
O64-O064_03


257 / 4e-86
O54-O054_06


246 / 8e-82
O92-O092_07


172 / 3e-53
O74-O074_09


151 / 3e-45
O65-O065_13


124 / 3e-35
O107-WclZ

bDGal(1->

->3)aDGalNAc

120 / 7e-34
O117-WbeD

bDGal(1->

->3)aDGalNAc

120 / 1e-33
O178-O178_09


117 / 1e-32
O153-O153_06


117 / 1e-32
O160-O160_08


116 / 3e-32
O28-O028ab_02


116 / 4e-32
O174-WbcZ


114 / 1e-31
O37-O037_13


109 / 1e-29
O112-WfeJ


108 / 3e-29
O71-WdaK

bDGal(1->

->3)aDGalNAc

108 / 2e-29
O171-O171_13


107 / 9e-29
O70-O070_13


103 / 2e-27
O104-WbwC

bDGal(1->

->3)bDGalNAc

101 / 8e-27
O7-WbbD

bDGal(1->

->3)aDGlcNAc

100 / 3e-26
O155-WclG


100 / 2e-26
O5-O05_15


98 / 2e-25
O185-O185_03


95 / 1e-24
O146-WbwW


94 / 2e-24
O127-WbiP


94 / 2e-24
O90-O090_13


94 / 2e-24
O33-O033_09


91 / 5e-23
O55-WbgO


89 / 2e-22
O55-WbgO


89 / 2e-22
O128-WbsK

bDGalNAc(1->

->4)aDGal

84 / 1e-20
O86-WbnJ

bDGal(1->

->3)aDGalNAc

80 / 1e-19
O86-WcmC

bDGal(1->

->3)aDGalNAc

80 / 2e-19
Enzymes
FlippaseMQRFFKVISYTAFLTFIKMLCGIFISKAIAIYAGPSGMALFGQM QGFTTMLTNLGNSPNNSGVIKYTAEFEHKGIDVYSQWWKAAIYWSFFVYITLFMLVVF FSEEISIFLTGKNDYRWLVISAGMLIPLSALGVLCSSIYNSFRDYKNFFLSGMISTLI TSVVIIYIILSYGLIGAMVAAVIQPALIGGGVFIFSLKEKWCRLKYFIGPITKGAKND ILKYVAMISVSAIVGPLSIIILRTFLIEQVGWEIAGEWQSVWKISEVYLGVITLTLST YYLPVLAKTRDYQQLVLELRRTVKVIFPLIVLMAIFIYILRDYIIYILFSKDFYNARE LFLIQLLGDVIKIASYIYAYPMLAKGKIKFFIFTEILFCITLITLSFFLINIFGVHGA NIAYASNYLLYLIVVIMSFKRLYAQSCN
Trembl: B7UEE4
PolymeraseMNYEDFFALAYNNIVEFFVISIFFLFFFVFTLRRFGAAGIIDPF HFIFSFVFSTSYAVIIILYINNEIELFYLVLLTLYSISFLFPIYFFRNRXKDLVSKYI YGFFSSINTSHYVTRIFILLYFIILIPLIYVKGFSLFTSTNRFEDNSGIGGLARFYDI IWLFVAGSFILYYKRILLYGGTIRKTILFFPFLAFFILNMLVIGSKSELVQYVLFYYL IISAYGYKFKLSIAKLTILGGLSLCFALIVLFFNFKMEGDGDFSNIINESFLRLLDRI MSNGDMYYLGLPHNVIEKIKTNNVLIDFFAPVLSSKXISHLAGYDVYTYDIGKQILLF HYPFYDIAGGPVEHFDLFGYKHFGIIGGIMFSAFLGMGVVILRNLVFLSRGNVFMTIV TCSIYFKMLAVILKPSILFAFMFDFLSVYISVGVISILLVGKRS
Trembl: B7UEE7
Literature
  • First Author: Fratamico PM. "Sequencing of the Escherichia coli O2, O28ac, O63 and O42 O antigen clusters and detection of pathogenic strains by multiplex PCR assays targeting virulence genes in the respective O-antigen gene clus". Not specified.