O-Antigen Description

Serogroup:O87
Serotype H:
Serotype K:
Strain:M1269
Structure:
->3)bDGalf(1->4)aDGal(1->3)aDGalA4Ac(1->3)bDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgL
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgN

GT NameDonorAcceptorScore / e-value
O115-WegK


88 / 2e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgO

aDGal(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O120-O120_15


363 / 9e-126
O22-WbhP


248 / 7e-81
O18-wekW


172 / 1e-51
O128-WbsH

aDGal(1->

->3)bDGalNAc

145 / 5e-42
O76-O076_08


145 / 7e-42
O113-WbnE


144 / 2e-41
O3-WclR


140 / 9e-40
O40-WffO


133 / 4e-37
O110-O110_02


133 / 2e-37
O55-WbgM


132 / 5e-37
O55-WbgM

aDGal(1->

->3)bDGalNAc

127 / 2e-35
O69-O069_12


121 / 6e-33
O116-O116_10


115 / 6e-31
O86-WbnH


111 / 2e-29
O86-WbwH


111 / 2e-29
O86-WcmA

aDGalNAc(1->

->3)bDGalNAc

111 / 2e-29
O127-WbiN


111 / 2e-29
O90-O090_04


111 / 2e-29
O111-WbdM

aCol(1->

->3)aDGlc ->6)aDGlc

110 / 4e-29
O142-O142_03


102 / 1e-26
O121-WbqH


100 / 9e-26
O18-wekV

aDGlc(1->

->4)aDGal

99 / 2e-25
O89-O089_06


97 / 8e-25
O51-O051_12


96 / 3e-24
O101-O101_06


94 / 1e-23
O142-O142_12


89 / 8e-22
O103-WbtF


88 / 2e-21
O148-WbbG

aDGlc(1->

->3)aDGlcNAc

85 / 2e-20
O19-O019_11


84 / 5e-20
O56-WfaQ


83 / 1e-19
NMR
1H-NMR5.19 4.18 4.22 4.14 3.95 3.67 3.69 5.20 3.92 4.08 3.94 4.08 3.72 3.76 5.21 4.02 4.18 5.89 4.32 2.03 4.67 4.02 3.92 4.18 3.72 3.81 3.85 2.10
Solvent: D2O
Temp: 20C
pD:
Ref: TSP 0.00 ppm
Comment: 1H-NMR [2]
13C-NMR110.3 81.6 85.8 82.5 71.5 64.0 95.6 68.3 70.5 77.9 71.8 62.1 98.3 67.9 72.3 69.4 71.8 175.0 23.6 176.2 102.7 52.0 78.6 66.1 76.1 62.3 21.6 174.0
Solvent: D2O
Temp: 20C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Non-Sugar Components
- Acetate
Enzymes
FlippaseMRVLGPEFFGVLGFCQASMQYLVLITDYGFNWTATQQIAKHRDNKLKINEIFWSVIFAKIFLASISFILL FVICWNVPKYHDVWYVLLSFSPFLLGNVIYPIWFFQGMEKMKAITVCTISARFLLIPLTFLLVHNSDDIW IAAIIQSSVNLLAGILSCCLIFKYRWISGFEFNLIKVKESICEGWHVFISTSAISLYTTSTTVILGFVAG NTAVGYFNAANTVRNAAQGLLNPVTQAIYPRVSALYEIDYVKALNLIKKMLRYIGGIAFLGSVILFFLAP VIIKYGLGDSYNNAVSILRWMAFLPFIILLSNIFGVQTMLTHGYKKQFSNILTVSGVLNLCIIYPLVCLY SADGAAIAMLITEIFVSFTMFCFLKNKKINIFK
Trembl: B5L3M8
PolymeraseMSYIISVSTLIVILFFERNRMILPLSAVIISGVVVFICLSGNYYNGYDWINYLDNFQCLKYLGVYCWDKY DISYTLIVYLCSKIFDDYHSVVVVISVINTYCLCFFAYKNCRNPLLFITIYFSLYAWVLYSETLRQSLAV SFVFLSLSAFNKKHFVKSLALLGVASTFHISALFFLVLYIIKYKTNLTYKLFVLSFLIGAVFLPYIAASF FYLNPRILSYFLDTNWNEAQNLSIIQVSTTLFSLLLLFMVWRRLYNNNMLITKDEWGKANLIMFSLFSVL FALGKLHAQYFEVLSRVNYYIAIPAFVYLSNRIEDLRVTNKIIIYPFLMVYLLYSPVRFFYSLQKFDEYN NFYVDKLLLNKKINIEYLKNTRCSYLGNKFSACK
Trembl: B5L3N1
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Zdorovenko EL. "Structure of the O-polysaccharide of Escherichia coli O87". Carbohydrate Research. (2015),