O-Antigen Description

Serogroup:O40
Serotype H:
Serotype K:
Strain:
Structure:
->2)bDGal(1->4)bDMan(1->4)aDGal(1->3)bDGlcNAc(1->
Comment:- Structure [1]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffO

aDGal(1->

GT NameDonorAcceptorScore / e-value
O3-WclR


513 / 0.0
O113-WbnE


302 / 9e-102
O69-O069_12


280 / 3e-93
O18-wekW


249 / 5e-81
O128-WbsH

aDGal(1->

->3)bDGalNAc

219 / 4e-70
O110-O110_02


215 / 3e-68
O55-WbgM


203 / 5e-64
O55-WbgM

aDGal(1->

->3)bDGalNAc

202 / 1e-63
O87-WfgO


140 / 8e-40
O148-WbbG

aDGlc(1->

->3)aDGlcNAc

136 / 2e-38
O19-O019_11


136 / 2e-38
O120-O120_15


125 / 1e-34
O51-O051_12


122 / 2e-33
O133-O133_08

aDGalA(1->

->3)aDGlcNAc

99 / 2e-25
O121-WbqH


94 / 9e-24
O22-WbhP


88 / 1e-21
O116-O116_11


82 / 2e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffP
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffQ
NMR
1H-NMR4.47 3.72 3.72 3.87 3.71 3.78 3.78 4.84 4.20 3.76 3.74 3.52 3.85 4.16 5.40 3.88 3.89 3.68 3.84 4.88 3.81 3.74 3.69 3.42 3.74 3.91 2.06
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0.0 ppm
Comment: 1H-NMR [1]
13C-NMR103.20 78.90 75.20 70.40 76.70 62.40 102.20 71.30 73.00 79.20 76.50 62.20 100.80 70.00 70.80 77.60 71.80 61.50 102.60 56.10 81.50 72.30 76.90 62.30 23.90 175.50
Solvent: D2O
Temp: 30C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [1]
Enzymes
FlippaseMFQNGVYISFYSFIAKATVFLCGPLTLLLISHKLSTEEIAFYYTFFNLIALQQLVELGLGFTLKQCISHA YKIENDVWLYDSKKIVKSYIQFGLYWFIGVSCIIIFVVGPLGLIFYGDYEGSIKWQGAWLGTVGVLAFSI ILVPIQIAIEATQNQIANISLSSYIFSHNSLSLWVFIYNDFKLYSIPLSMLIATYFLLIALKNHYIQLYN KLAFVKEMDKFWTIFSKLWPLFSRVAIVWGVGFLLWNGFNLISFKIFSPEEAGRIIFSITLARAGFTIAE SIISAQTTVVSNMISKGENTEAAKYYRKYQLISFAVLIIGYGFYYVVKCFFSDFYLFDKLMPNSFITSVF VFFVLLLILTTNSNFIRCYKIEPFVKVSVWHSLGVPMSFLLSSLYFPMYLYPCSFVLFISIIWSQLISKR ILSKIG
Trembl: B5L435
PolymeraseMSHFGGGLMKSVNKFNFYLAIFIGMFDLTIFSTGNSLGQALTTVLLLFSILSDINKVFLKPFFFVISYIV LALLVSLFHGETSYHYSFIIVKTGLILFNAMVISQILILYADKKQISNFVNFIFLIQTISLLLYSNELFQ MMRGFFLSARSEHLYENFGDSYWYRDATISNQGYSGYALGALPLVIIAVHNIMKSKFFSIRYFVAVVCCG LGVSIAMLNGRSVFLFIPLYMIYLMLRPKEICLIYKIIPVILIIVSAIIIALTNLIYPSNFVLAFFEQKG KSYGIDSVDDLMYNHTILHFDITLFGLGKYLLSDGSAFVRSDIGYYRQMGVGGIFLVLFYIFSIWLAVRY VIYRDLSLFILFIILLVNFKQEAFNNAMLMYGAFLLAAYWVARDKIEITKK
Trembl: B5L433
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Zhao, G. "Structural relation of the antigenic polysaccharides of Escherichia coli O40, Shigella dysenteriae type 9, and E. coli K47". Carbohydrate Research. 342(9). (2007), pp 1275-1279 PubMed: [17395169]