O-Antigen Description

Serogroup:O150
Serotype H:
Serotype K:
Strain:
Structure:
                                        bDGlc(1->2)
                                                 |
->3)bDGlcNAc4SLac(1->2)aLRha(1->2)aLRha(1->3)aLRha(1->3)bDGlcNAc(1->
Comment:- Structure [1]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgH

GT NameDonorAcceptorScore / e-value
O51-O051_08


260 / 1e-86
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgI

aLRha(1->

GT NameDonorAcceptorScore / e-value
O135-RfbF


242 / 2e-79
O129-RfbF


241 / 4e-79
O13-RfbF


241 / 4e-79
O19-O019_09


179 / 4e-55
O69-O069_11


176 / 3e-54
O19-O019_08


159 / 1e-47
O120-O120_14


152 / 8e-45
O148-WbbQ


140 / 1e-40
O10-O010_09


140 / 2e-40
O54-O054_10


123 / 3e-34
O146-WbwV


122 / 7e-34
O35-WcnY


122 / 4e-34
O147-WfbY


122 / 6e-34
O2-wegQ

aLRha(1->

->3)aLRha
->2)aLRha

118 / 1e-32
O50-O050_12


118 / 1e-32
O133-O133_07

aLRha(1->

->2)aLRha
->4)aDGalA

114 / 4e-31
O71-WdaM

aLRha(1->

->4)bDGal

100 / 4e-26
O177-WbdY


93 / 1e-23
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgK

aLRha(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O49-O049_13


300 / 2e-102
O129-RfbG


286 / 6e-97
O135-RfbG


286 / 6e-97
O13-RfbG

aLRha(1->

->3)bDGlcNAc

286 / 6e-97
O105-WbsY


283 / 2e-95
O154-O154_12


263 / 1e-87
O10-O010_11


92 / 2e-23
O100-O100_10


88 / 9e-22
O180-wfcT


85 / 5e-21
O97-O097_05


84 / 1e-20
O154-O154_14


84 / 2e-20
NMR
1H-NMR4.61 3.79 4.01 3.55 3.47 3.77 3.88 5.12 4.10 3.84 3.30 3.65 1.23 5.15 4.04 3.85 3.48 3.68 1.31 5.08 3.90 3.91 3.63 3.96 1.23 4.60 3.68 3.70 3.40 3.32 3.66 3.88 4.58 3.29 3.48 3.42 3.42 3.76 3.88 4.62 1.35 179.40 77.70 18.80
Solvent: D2O
Temp: 40C
pD:
Ref: Acetone 2.225 ppm
Comment: 1H-NMR [2]
13C-NMR104.10 56.90 79.70 74.60 75.60 61.70 102.50 80.30 71.00 73.80 70.60 18.10 102.20 79.30 71.30 73.40 70.80 18.10 100.90 80.40 77.80 73.70 70.50 17.70 101.50 57.40 82.60 70.30 77.60 62.80 105.20 74.40 76.80 70.70 77.40 62.00 179.40 77.70 18.80
Solvent: D2O
Temp: 40C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMKKQIIKNISANFTNLIVSIFIGLLLTPLLVKSLGIEVYGVLPIALFLTFYMGVIAQALTASVNRFLIED FIKGAYTEASVVFSTSFILILGYLSVISIGFIYPILHISDFFNIPPGYEHDAVLLFSCVIFSFVIAMISS SLSVSMYAKNRIDLMQYGNILRNITKVLIIIMFVYLSEINLTKIGISIVLSELFYLIYVIITWKILTPQL SLQIGFFRKDKVKRLTSFSGWILFDQIGSILFLKTDLILVNSLSGSKANGEYSIATQFSDLLRSLAGLVA GSLGPMMVILYEEKKLEELTSLTITFVKFLSLTIAIPIIILCVYSKEILELWLGSGFVFLSPLICIVTLP LIINLGTLPILSINIAVKKIQVPALINFFLAIVGIIGSVVLFKTTTLGYYAVAISYVITLTIKNSIFIPW YATIILNKPRYLFFKTHLITIIFSSLFFIFIYILKSIMQITNLNLLFELILVGCFGLLSTFPFYSKEE
Trembl: B5L3C8
PolymeraseMLILTNNIILLIFIIYTFLVFISALGVKLNSRGLDNFSCLITVLTFVILIFARTGLGVDESTYLESYHYY VQGGEADFEYGFNILFWGVRLFGVTESSFNTIFPLLILTALYFAVTVSVKNPFRSFVLIFTIFSSFFLDF SFNAYRQGLSFWFVLLAIESHLSGNRWKFIVYCLIGLGFHWSAAVVLFMLFLTRFLSTRLAIFCNIFLFF LTLVAAMMPLHVLSMLVTMIQYLPLNSSYLQKVIFYLTTIKSSFYDLNFFGRAPLIIYALILISLLAIYR KLLPIVQFKLLILLLVYSVLLLEMSYSFRNYYWVLPFTPFIMAKILSCYSNKKKVMVMYTMFSTGLWSLS IASFYSFPILSMIFQ
Trembl: B5L3D3
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov, AV. "Structure of the O-polysaccharide of Escherichia coli O150 containing 2-acetamido-4-O-[(S)-1-carboxyethyl]-2-deoxy-d-glucose". Carbohydrate Research. 342(3-. (2007), pp 648-652 PubMed: [16997291]