O-Antigen Description

Serogroup:O130
Serotype H:
Serotype K:
Strain:
Structure:
Gro(2-P-4)bDGalNAc(1->3)
                      |
               ->4)aDGal(1->6)bDGlc(1->3)bDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffF
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffH'

bDGalNAc(1->

->4)aDGal

GT NameDonorAcceptorScore / e-value
O102-WelM

bDGalNAc(1->

->3)aDGal

269 / 7e-90
O48-O048_06


185 / 2e-57
O37-O037_11


156 / 2e-46
O128-WbsK

bDGalNAc(1->

->4)aDGal

97 / 8e-25
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

97 / 2e-25
O165-WcnW


94 / 3e-24
O182-O182_10


94 / 5e-24
O157-WbdN


88 / 4e-22
O55-WbgP


86 / 3e-21
O178-O178_09


86 / 2e-21
O55-WbgP


86 / 3e-21
O24-WfaM

bDGlc(1->

->3)bDGalNAc

86 / 2e-21
O153-O153_06


86 / 2e-21
O143-WfdV


84 / 1e-20
O160-O160_08


84 / 1e-20
O86-WbnJ

bDGal(1->

->3)aDGalNAc

83 / 3e-20
O23-O023_06


83 / 3e-20
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

83 / 3e-20
O30-O030_06


83 / 2e-20
O125-O125_04


83 / 4e-20
O86-WbwJ


81 / 9e-20
O86-WcmC

bDGal(1->

->3)aDGalNAc

81 / 2e-19
O113-WbnA


81 / 2e-19
O130-WffJ


80 / 2e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffI

aDGal(1->

->6)bDGlc

GT NameDonorAcceptorScore / e-value
O102-WelN

aDGal(1->

->6)bDGlc

231 / 3e-74
O81-O081_10


192 / 2e-59
O56-WfaQ


160 / 6e-47
O27-WejX


150 / 1e-43
O152-WfgE


149 / 3e-43
O173-WcmX

aDGlc(1->

->2)bDGlc

137 / 2e-38
O24-WfaO

aDGlc(1->

->2)bDGlc

135 / 9e-38
O85-WfbQ


133 / 4e-37
O29-WffY


127 / 4e-35
O144-O144_03


127 / 5e-35
O169-O169_04


127 / 2e-35
O183-wbaT


122 / 1e-33
O18-wcxD


119 / 3e-32
O187-O187_10


112 / 5e-30
O66-WfaB


104 / 4e-27
O178-O178_05


87 / 2e-21
O153-O153_02


87 / 2e-21
O65-O065_10


84 / 5e-20
O110-O110_03


82 / 3e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffJ

bDGlc(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O102-WelO

bDGlc(1->

->3)bDGalNAc

262 / 8e-89
O46-O046_08


255 / 3e-86
O81-O081_11


254 / 1e-85
O21-WclQ


253 / 5e-85
O134-O134_08


252 / 5e-85
O27-WejU


250 / 3e-84
O157-WbdN


241 / 3e-80
O61-WeiL


234 / 6e-78
O24-WfaM

bDGlc(1->

->3)bDGalNAc

231 / 2e-76
O140-O140_14


174 / 1e-54
O143-WfdV


173 / 5e-54
O38-O038_09


172 / 8e-54
O112-WfeI


165 / 5e-51
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

146 / 8e-44
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

138 / 1e-40
O82-O082_09


136 / 5e-40
O165-WcnW


130 / 1e-37
O93-O093_02


128 / 4e-37
O91-WbsA


123 / 3e-35
O182-O182_10


123 / 5e-35
O30-O030_06


122 / 1e-34
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

118 / 2e-33
O79-WbdX


113 / 2e-31
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

102 / 3e-27
O128-WbsK

bDGalNAc(1->

->4)aDGal

97 / 2e-25
O55-WbgP


90 / 7e-23
O55-WbgP


89 / 7e-23
O113-WbnA


84 / 9e-21
O34-O034_10


81 / 1e-19
O130-WffH'


80 / 2e-19
NMR
1H-NMR4.63 4.08 3.82 4.56 3.78 3.68 3.82 4.94 3.72 3.93 4.41 3.94 3.68 3.82 4.64 3.29 3.51 3.60 3.64 3.73 4.03 4.96 4.06 3.85 4.13 3.67 3.68 3.82 3.72 4.33 3.72 3.76 3.76
Solvent: D2O
Temp: 30C
pD:
Ref: Acetone 2.225 ppm
Comment: 1H-NMR [2]
13C-NMR105.20 54.40 72.10 74.90 76.00 62.50 23.80 99.90 69.00 81.30 77.20 71.60 62.00 106.00 74.70 77.20 70.40 76.00 66.80 102.90 52.50 82.70 69.40 76.10 62.30 63.10 79.50 63.10
Solvent: D2O
Temp: 30C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMLDILRIQEKYFMKFTLKKTNIQNRNVVIYLISDLLAKALPFLFIPVLTKYLTPEQYGNIALFNIGVETF LIIIIMGGNSYYKIEYPKFKDPILSLYIIIYNVTLLFLVFFILSIVIWFFYERIYIIDVLPLILLCAYFQ SLFYLYISYYQCNEKALVVGMVNLFFSLSSSLLMILFLVEFKQAESSRYWSLLGGLIASVLLLGSILANK SNRKYKLVNKIDFELIKFGVGVFPHAVSWWARSGMERLLIGWFLSVSTLGIYSLAMQLTSIMPLFCNAIN QALMPRIVRCLNDNKIEETKKILVKSSLIVAIACVFSSVVMPLFLGYVLNDRYHEALEYLPYMILSFVFQ GVIIIYTNVLYFYKQVKYLSVATFGTSCVHLLLSMLLIKINLNVYSVIISSVITFLFASIVLVRKAYQIM SERY
Trembl: B5L466
PolymeraseMLTKRTTKNTSFLYFSLFCIYFSVSFSPVNPTYILGCGLILILFMQVLLRMRIQKFTLITIVFAMMFLLE QLIGINIVSFYPEGPVYLTPLLFSYSILISACVIEGFQGLKSDSRLIIYKRVYNYAIIFLVIELFTRVLN YNKENNGFYSLKYSVPYFDSNFTGLVILSLCSYLLYLKYVKGNERKIHRRILYFLLLATFSRGAIAALIL TRIGLGSKKRIRGKAFLIIAVAVVIFSMLTIEYIEQSQSYSSIDGSFNSKFYIISQALSFYESLPILVHW FGIGMGNTSQFIGIFAHNIFVTMILEMGIVGTVLFLLYVFYTLKLSNGYALFIWVPIFVGGISLFSAFSP FAFIICALICCENMVDKKYEF
Trembl: B5L469
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov, AV. "The structure of the glycerophosphate-containing O-specific polysaccharide from Escherichia coli 0130].[Article in Russian". Bioorg. Khim. 33(1). (2007), pp 64-68 PubMed: [17375660]