O-Antigen Description

Serogroup:O168
Serotype H:
Serotype K:
Strain:
Structure:
aLFuc(1->3)
         |
  ->4)aDGlcNAc(1->4)aDGlcA(1->3)aLFuc(1->3)bDGlcNAc(1->
Comment:- Structure [1]
- aLFuc is O-acetylated in position 2/3/4, in total 50%
- aDGlcNAc is O-acetylated in position 6, in total 50%
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeV

->4)aDGlc

GT NameDonorAcceptorScore / e-value
O41-O041_06


121 / 2e-34
O11-WdaG


114 / 1e-31
O125-O125_13


114 / 2e-31
O36-O036_15


112 / 6e-31
O84-O084_13


111 / 1e-30
O41-O041_12


110 / 2e-30
O43-O043_13


108 / 2e-29
O159-WfgS


106 / 6e-29
O11-WdaD


105 / 1e-28
O168-WfeY


103 / 6e-28
O156-O156_14


103 / 6e-28
O184-O184_15


102 / 3e-27
O173-WcmU

aLFuc(->

->4)aDGlc

98 / 1e-25
O43-O043_04


92 / 8e-24
O157-WbdO


86 / 1e-21
O36-O036_08


84 / 9e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeW
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeX
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeY

->4)aDGlc

GT NameDonorAcceptorScore / e-value
O156-O156_14


508 / 0.0
O84-O084_13


484 / 0.0
O159-WfgS


483 / 0.0
O41-O041_12


474 / 0.0
O36-O036_15


467 / 0.0
O125-O125_13


263 / 4e-89
O184-O184_15


263 / 3e-89
O11-WdaG


262 / 5e-89
O43-O043_13


258 / 3e-87
O11-WdaD


125 / 4e-36
O43-O043_04


112 / 3e-31
O173-WcmU

aLFuc(->

->4)aDGlc

108 / 1e-29
O168-WfeV


103 / 6e-28
O111-WbdL

aDGlc(1->

->4)aDGal

100 / 2e-26
O36-O036_08


95 / 9e-25
O41-O041_06


83 / 1e-20
NMR
1H-NMR5.11 3.68 3.95 3.79 4.72 1.25 5.17 4.13 3.91 3.87 3.72 3.71 3.83 5.17 3.57 3.73 3.73 4.18 4.97 3.88 3.89 3.91 4.31 1.14 4.55 3.80 3.63 3.31 3.44 3.59 3.96
Solvent: D2O
Temp: 30C
pD:
Ref: TSP 0.0 ppm
Comment: 1H-NMR [1]
13C-NMR99.70 69.20 70.70 73.30 68.00 16.90 99.60 55.30 73.30 79.30 73.30 60.80 102.00 73.30 74.60 79.30 73.70 175.70 101.60 68.70 74.60 73.70 68.40 16.50 101.50 57.00 81.90 77.60 63.20
Solvent: D2O
Temp: 30C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [1]
Enzymes
FlippaseMFRQINFKNLEIMKQILISFSFRLMGPVIMLLTTPQLLSTLGNVEYGVWSLLITTISWLTICDFGISNQI RNESKILIVQDNKESIREIYTAAVIISFFITLLCCVIISFINIDLIYKLFLSCVFLFAIETNICRALCLS LNKPELASAVTNIPNLFLLIYVFCYSSFNINNVMDIYCYGSAMMFVSIFIILYKFNIKLFWPVFHPSYLR FSIMKYSLLRGGGGFFMVQLVSMGLIISDRYIISSIFGVEDVTKYDLIFKVSNFCIMFFSIVNMVLWSKF TEFWMQGFYTKIKVIFKVFDLCFLLLVIVLILILNHIHWIFELWLNVTNENYNEVYITGIVLYLVGYYWM SAYSSFLNGISIIKKQFIIQGGGLLIKAITLLIAMNILKVFKVEYIILLGGACLFIVGFLFRKCAHDKIN SCI
Trembl: B5L3Q8
PolymeraseMNCKFNIWDIQLGLILISVLSYAFLNLGFLPLNISHLIILFVLITLSVNLLISQSIKITGLFLTLFVSFI LLSAYSLLKYYDVQKVKNIINFFIFFSVAAIVINNCSADKIIKFYYKLTKIFIFFALLQWVLYYLNIGTL YTYSFLGLKEVNISTSGYLIRLFSIASEPAALCGILLPAIYLSINRIVNKGKEVTLSYSVIVLFVILNTF SLVGYIYIIICLIVALYVGNKISLSKIFIFTICLALLVFILFQSDSIQQRLNEITSLDKMASSDNLSVIA IYSNLQIALISLSDNLIFGGGIFSHPYTYDHYISQLYAGGGPRMELNKDDAASLYIRALSETGILGFCIL NGLIIYLMKRCDKSKINYPYNIAFTIAFALLGIRAGSVNYIIIWFYFFSAIRFVNEGRLK
Trembl: B5L3R2
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov, AV. "Antigenic polysaccharides of bacteria: 41. Structures of the O-specific polysaccharides of Shigella dysenteriae types 4 and 5 revised by NMR spectroscopy].[Article in Russian]". Bioorg. Khim. 34(4). (2008), pp 513-21 PubMed: [18695724]
  • First Author: Perepelov, AV. "Close relation of the O-polysaccharide structure of Escherichia coli O168 and revised structure of the O-polysaccharide of Shigella dysenteriae type 4.". Carbohydrate Research. 342(17. (2007), pp 2676-81 PubMed: [17880932]
  • Bioorg. Khim. (1977), pp 1226–1233