O-Antigen Description

Serogroup:O148
Serotype H:
Serotype K:
Strain:
Structure:
->3)aLRha(1->3)aLRha(1->2)aDGlc(1->3)aDGlcNAc(1->
Comment:- Structure [1]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbbR

aLRha(1->

GT NameDonorAcceptorScore / e-value
O133-O133_07

aLRha(1->

->2)aLRha
->4)aDGalA

94 / 6e-24
O69-O069_11


88 / 6e-22
O146-WbwV


84 / 1e-20
O129-RfbF


82 / 8e-20
O13-RfbF


82 / 8e-20
O19-O019_08


82 / 8e-20
O135-RfbF


81 / 1e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbbQ

aLRha(1->

GT NameDonorAcceptorScore / e-value
O69-O069_11


261 / 1e-86
O120-O120_14


249 / 5e-82
O19-O019_09


221 / 1e-71
O19-O019_08


188 / 1e-58
O10-O010_09


152 / 8e-45
O133-O133_07

aLRha(1->

->2)aLRha
->4)aDGalA

146 / 9e-43
O150-WfgI


140 / 2e-40
O35-WcnY


138 / 8e-40
O129-RfbF


137 / 3e-39
O135-RfbF


137 / 2e-39
O13-RfbF


137 / 3e-39
O54-O054_10


134 / 2e-38
O146-WbwV


132 / 1e-37
O147-WfbY


131 / 3e-37
O2-wegQ

aLRha(1->

->3)aLRha
->2)aLRha

120 / 2e-33
O50-O050_12


120 / 2e-33
O177-WbdY


105 / 1e-27
O71-WdaM

aLRha(1->

->4)bDGal

95 / 3e-24
O139-WfaI


83 / 3e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbbG

aDGlc(1->

->3)aDGlcNAc

3 | 1
GT NameDonorAcceptorScore / e-value
O19-O019_11


635 / 0.0
O51-O051_12


264 / 4e-87
O69-O069_12


172 / 1e-51
O110-O110_02


164 / 5e-49
O128-WbsH

aDGal(1->

->3)bDGalNAc

160 / 2e-47
O113-WbnE


154 / 9e-45
O3-WclR


142 / 2e-40
O55-WbgM


137 / 9e-39
O55-WbgM

aDGal(1->

->3)bDGalNAc

136 / 1e-38
O40-WffO


132 / 7e-37
O18-wekW


128 / 3e-35
O87-WfgO


85 / 2e-20
O22-WbhP


85 / 2e-20
O120-O120_15


80 / 9e-19
NMR
1H-NMR5.09 4.22 3.92 3.55 3.87 1.33 5.08 4.15 3.86 3.55 3.87 1.29 5.53 3.64 3.75 3.48 3.63 3.81 5.02 4.12 4.04 3.78 4.04 3.81
Solvent: D2O
Temp: 27C
pD:
Ref: Acetone 2.225 ppm
Comment: 1H-NMR [1]
13C-NMR103.40 68.20 76.40 71.80 70.80 18.30 102.80 71.10 79.50 72.70 70.80 18.10 99.20 78.00 73.80 70.60 73.70 61.70 95.60 53.40 77.10 72.50 73.20 61.70
Solvent: D2O
Temp: 27C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [1]
Enzymes
FlippaseMKKNILLLFLVHGANYLFPFIVLPYQTRILSIETFADVAKIQAAVMLLSLIVNYGYNLSSTRAIARAVSQ AEINKIYSETLIVKLLLATICLALGYVYLMYVKEYSLIYPFIISSIYLYGSALFATWLFQGLEKMKAIVI ATTIAKLTGVILTFILVKSPNDIDAALFTQNIGMFISGIISIYLVRKNKYATVIYFRLKNIILSLKEAWP FFLSLAATSAYTYFNVILLSFYAGDYVVANFNAADKLRMAAQGLLIPIGQAVFPRLSKLEGYEYSSKLKI YAIRYAIFGVCISAGLVFLGPMLTTIYLGKEYSLSGEYLQSMFLLPAIISISTILSQWMLIPQGKEKILS RIYILGAIFHLLYAFPLVYYYGAWGMVISILFTEVLIVLFMLKAVK
Trembl: Q0H8D2
PolymeraseMTYFTGFILILFAIIIKRLTPSQSKKNIVLIANAFWGILLVGYAFNEQYFVPLSATTLFFILAFLFFFSM TYILIARSGRVVFSFGTGFIESKYIYWFAGMINIISICFGIILLYNNHFSLKVMREGILDGSVSGFGLGI SLPLSFCCMYLARHENKKNYFYCFTLFSFLLAVLSTSKIFLILFLVYIVGINSYVSKKKLLIYGTFVFGL FALSSIILGKFSSDPEGKIISAIFDTLRVYLFSGLAAFNLYVEKNVTLPENLLLYPFKEVWGTTKDIPKT DILPWINTGVWDTNVYTAFAPWYQSLGLYAAIIIGILLGFYYGIWFSFRQNLAVGFYQTFLCFPLLMLFF QEHYLLSWKMHFIYFLCAILLAMRKALEYE
Trembl: Q0H8D1
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Feng, L. "Structural and genetic evidence that the Escherichia coli O148 O antigen is the precursor of the Shigella dysenteriae type 1 O antigen and identification of a glucosyltransferase gene". Microbiology. 153. (2007), pp 139-47 PubMed: [17185542]