O-Antigen Description

Serogroup:O112 ac
Serotype H:
Serotype K:
Strain:
Structure:
bDGlcNAc4,6(S)Pyr(1->3)
                     |
              ->4)aDGalNAc(1->4)aDGlc(1->4)bDGal(1->3)bDGalNAc(1->
Comment:- Structure [2]
- O-acetylation in bDGlcNAc4,6(S)-Pyr is 70%~ in position 3
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeJ

bDGal(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O178-O178_09


272 / 5e-92
O153-O153_06


272 / 5e-92
O5-O05_15


270 / 3e-91
O71-WdaK

bDGal(1->

->3)aDGalNAc

262 / 2e-88
O174-WbcZ


259 / 3e-87
O146-WbwW


257 / 3e-86
O185-O185_03


251 / 5e-84
O171-O171_13


248 / 1e-82
O37-O037_13


244 / 3e-81
O155-WclG


236 / 4e-78
O160-O160_08


236 / 3e-78
O104-WbwC

bDGal(1->

->3)bDGalNAc

231 / 5e-76
O33-O033_09


229 / 4e-75
O70-O070_13


211 / 3e-68
O107-WclZ

bDGal(1->

->3)aDGalNAc

206 / 2e-66
O117-WbeD

bDGal(1->

->3)aDGalNAc

206 / 3e-66
O131-O131_11


191 / 8e-61
O7-WbbD

bDGal(1->

->3)aDGlcNAc

172 / 2e-53
O65-O065_13


156 / 3e-47
O64-O064_03


118 / 7e-33
O28-O028ab_02


116 / 3e-32
O63-WbuP


108 / 3e-29
O74-O074_09


106 / 1e-28
O54-O054_06


103 / 1e-27
O23-O023_06


89 / 1e-22
O114-WbuP

bDGal(1->

->3)aDGlcNAc

88 / 3e-22
O167-WfdH


84 / 1e-20
O22-WbhQ


82 / 5e-20
O92-O092_07


80 / 1e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeK

GT NameDonorAcceptorScore / e-value
O107-WclY


149 / 7e-43
O117-WbeC


145 / 1e-41
O48-O048_07


120 / 7e-33
O119-WekI


98 / 5e-25
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeL
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeM

GT NameDonorAcceptorScore / e-value
O124-WfeS


101 / 2e-26
O164-WfeS


101 / 2e-26
O171-O171_11


87 / 1e-21
O144-O144_10


87 / 1e-21
O117-WbeA


84 / 8e-21
O107-WclW


83 / 3e-20
O185-O185_09


82 / 6e-20
O160-O160_05


82 / 6e-20
O112-WfeF


80 / 4e-19
NMR
1H-NMR4.55 3.80 3.55 3.42 3.43 3.78 3.93 5.34 4.20 3.97 4.45 4.05 3.72 3.80 4.89 3.51 3.92 3.64 4.20 3.68 3.88 4.59 3.56 3.73 4.01 3.68 4.96 4.14 3.88 4.14 3.74
Solvent: D2O
Temp: 55C
pD:
Ref: Acetone 2.225 ppm
Comment: 1H-NMR [2]
13C-NMR104.10 57.20 75.10 71.60 77.30 62.50 99.70 50.10 77.50 75.70 72.70 61.50 101.40 73.40 74.90 76.80 72.00 62.20 106.50 72.10 73.50 79.00 76.40 102.40 52.50 82.10 69.80 76.50
Solvent: D2O
Temp: 55C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMSMLLNLIIPIISFGIVSIMGLIMTPFFINNFGYEGLGLISNSNALIQSLFFAGGAFTTVYSREYSNAVN NIEKSVLLRELNNILTAIFFIAVLLSIVFYIFYIFKDNFSYNYYALVFLASAIIIISQSFNVFPFAANRL YINSVIDCARTLLRNILCMALFYLSIDNVLSNGWAMILSAVITLLVLKLVFKENKVFYVGRMSNNYNIKN SFWVCINQGGAYIFSFADVFLINLMLGHYIGGSYAVLIQIPVLLKSVSVVAIGSISSFTVKVHQRFEKDR TIIKKIINKVVVFFSFFISLAFILVDLYKESFFSIWLPTAVTSSMLKQFNYICIIMMLLSISSLVNIFLV AWGHFIIPAKATVFSAVVSVLVVVLLYFFNYKLSEMIIFSVIYLMLILKNLICYLYFFMQSGLSLIHFIF SLILSFCVITINFLVAKSIRYYIESDFLSIVILFFVMMTISLPLLWDFKKLREYI
Trembl: B5L3T4
PolymeraseMIKKNNIYRFYILVCVFSGFYIFGFFPAPYYLCLILGFVFLSLSKIKHVDKNILFLLCIVIIYMVFMLFN SRINVWSYYFIGLLTYFIIILLRNNLDYYQKIAIVRKTVLISLLLVILDTIYRFYYPREEYLLAIEQQGK IDYLFYGYKHSFLFQDSNFVGLYILSVFFLFRDNMSIFKWKKSILLTIIILIILSLSRAAIVALILTECI RMLCGMKVDVRLKIVSLIFMAIPTIYLLFVLVANIDDTSFESKFMLLNKFLTTFQERNFTELLFGWGLDN TREHWGIAAHSLFNTLLLEMGLVGFIIITISIVYCWCLNTKTLYHFMGLSIAFLSFGLIFTPFFIPLGLN IIMRDVSNEKL
Trembl: B5L3T0
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov AV. "The O-polysaccharide of Escherichia coli O112ac has the same structure as that of Shigella dysenteriae type 2 but is devoid of O-acetylation: a revision of the S. dysenteriae type 2 O-polysaccharide s". Carbohydrate Research. 343. (2008), pp 977-981 PubMed: [18308298]