O-Antigen Description

Serogroup:O112 ab
Serotype H:
Serotype K:
Strain:
Structure:
bDGlcNAc(1->3)
            |
     ->4)aDGalNAc(1->4)aDGlc(1->4)aLIdoA(1->3)bDGalNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeF

bDGlcNAc(1->

GT NameDonorAcceptorScore / e-value
O42-WbeX

bDGlcNAc(1->

->3)bDGalf

100 / 1e-25
O28-WbeX

bDGlcNAc(1->

->3)bDGalf

100 / 9e-26
O144-O144_10


93 / 2e-23
O66-WfaC


90 / 1e-22
O96-O096_07


89 / 3e-22
O113-WbnA


88 / 1e-21
O185-O185_09


82 / 1e-19
O160-O160_04


82 / 9e-20
O124-WfeS


81 / 7e-19
O164-WfeS


81 / 7e-19
O38-O038_09


81 / 1e-19
O112-WfeM


80 / 5e-19
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeG
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeH

GT NameDonorAcceptorScore / e-value
O140-O140_13


121 / 1e-33
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfeI

bDGalNAc(1->

->3)bDGalNAc

GT NameDonorAcceptorScore / e-value
O143-WfdV


243 / 5e-81
O38-O038_09


240 / 4e-80
O140-O140_14


229 / 8e-76
O134-O134_08


200 / 7e-65
O46-O046_08


199 / 2e-64
O21-WclQ


185 / 9e-59
O27-WejU


180 / 7e-57
O157-WbdN


176 / 2e-55
O61-WeiL


173 / 2e-54
O30-O030_06


173 / 2e-54
O24-WfaM

bDGlc(1->

->3)bDGalNAc

168 / 4e-52
O161-weiG

bDGlcA(1->

->3)bDGlcNAc

167 / 8e-52
O130-WffJ


165 / 5e-51
O81-O081_11


165 / 5e-51
O102-WelO

bDGlc(1->

->3)bDGalNAc

164 / 5e-51
O152-WfgD

bDGlc(1->

->3)bDGlcNAc

163 / 3e-50
O93-O093_02


160 / 3e-49
O91-WbsA


152 / 3e-46
O79-WbdX


148 / 2e-44
O165-WcnW


147 / 3e-44
O173-WcmW

bDGlc(1->

->3)bDGlcNAc

145 / 3e-43
O182-O182_10


142 / 1e-42
O82-O082_09


135 / 6e-40
O56-WfaP

bDGlc(1->

->3)bDGlcNAc

117 / 5e-33
O55-WbgP


96 / 3e-25
O55-WbgP


96 / 3e-25
O128-WbsK

bDGalNAc(1->

->4)aDGal

96 / 6e-25
O32-WfeA


90 / 7e-23
O28-O028ab_05


89 / 1e-22
O125-O125_04


84 / 6e-21
O113-WbnA


82 / 6e-20
O46-O046_05


82 / 5e-20
O134-O134_05


82 / 5e-20
O37-O037_11


82 / 5e-20
O115-WegI


80 / 2e-19
NMR
1H-NMR4.55 3.82 3.55 3.44 3.45 3.79 3.94 5.30 4.20 4.00 4.45 4.06 3.78 3.00 81.00 5.20 3.50 3.83 3.62 3.75 3.70 3.81 5.04 3.63 3.99 4.15 4.75 4.97 4.14 3.86 4.00 3.67 3.75 3.77
Solvent: D2O
Temp: 35C
pD:
Ref: Acetone 2.225 ppm
Comment: 1H-NMR [2]
13C-NMR104.10 57.20 75.20 71.80 77.40 62.50 99.90 50.20 77.70 75.80 72.30 61.80 97.60 73.10 75.20 76.70 72.30 62.20 104.90 70.90 69.70 76.00 69.70 175.00 102.40 52.70 81.00 69.70 76.70 62.60
Solvent: D2O
Temp: 35C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMNLLKGTIIYTLSNLTIKFGAVLLLPILTHLLNPEEYGMVGLYVTLTSFLTIILGLGFYTPLMKTQSEQK SNIATSSHVNFCAIIFLIAVYLLLLLFLYFILKSSLVIDLLGEVKLDSKLIYLAVIVSMFSAINIIMNTS FRMDENYILVAILSILSFVLFYSSAIIFIKQFNYGGLGYIYGNLLSSIIIFFISFTCYYRKLSIAFSWHN VKFLCGNGIPMVFVELSDKIIEASDRFILVRYISLSSLGVYTLALTGCKVLNVVFNSYISAILPSIYKSV ESREDSNYIKVKLENAYVLVVMMVFLGQLISKEIIDIIFPASYSNLFFVFILALPAISLQYYYFLDFYFH RSEDSRFILCFTIATSIINIILNLIFVPKYGVYASLLSTYISYLIRTLVEIKFIARRYKLKFSVLKVLMG SFVLYTVPLLYHYGYYTVLLRVTLSIVLFIGIIMFYKKSKIFN
Trembl: B5L401
PolymeraseMVNAKNFVLIIFDVICLFLNVFVYVPRLIIGVLTVDKTLIITFPLMLSVLAYNFIPPETYDLYRHYENYQ NFLNNNEVSFIRDFFLYFLFTVGRLFDLNNGFIAFVSCYILYFYWLKILYINFDYKANKKNFPLYFFIFF ITPPLVIYTGVRFSTGLILTLYGIVNWIQLRNVKLGIVYIICGLTAHFSMALIALIFIFTSYFNNIFSNK YLRVGLVFSALLVISFNEQLVRFLTTVIEFINQLFDWNFISIDTYITGKWGLERAQELNSTGQLVLGIRN YGMLFLILLFCPLISFNKNKYTNFYYVMCAVTILVFPFTAVFDRYGTFLIFFIVYYLSTLQKKTNIEIIY FLMLIVYLIFFRTTDIKDNISVYTESYSNILNLSLIKVLLGI
Trembl: B5L402
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov AV. "Structure of the O-polysaccharide of Escherichia coli O112ab containing L-iduronic acid". Carbohydrate Research. 343. (2008), pp 571-575 PubMed: [18062946]