O-Antigen Description

Serogroup:O29
Serotype H:10
Serotype K:
Strain:
Structure:
         aDGlc(1->6)aDGal(1->3)
                             |
->3)DGro(1-P-6)bDGlc(1->4)aLFucNAc(1->3)bDGlcNAc(1->
Comment:- Structure [2]
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffX
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffY

aDGlc(1->

GT NameDonorAcceptorScore / e-value
O56-WfaQ


188 / 8e-58
O173-WcmX

aDGlc(1->

->2)bDGlc

177 / 1e-53
O152-WfgE


173 / 4e-52
O24-WfaO

aDGlc(1->

->2)bDGlc

166 / 3e-49
O144-O144_03


162 / 5e-48
O81-O081_10


153 / 8e-45
O169-O169_04


140 / 9e-40
O183-wbaT


139 / 2e-39
O85-WfbQ


132 / 7e-37
O130-WffI


127 / 4e-35
O66-WfaB


125 / 2e-34
O18-wcxD


125 / 2e-34
O102-WelN

aDGal(1->

->6)bDGlc

115 / 8e-31
O27-WejX


113 / 3e-30
O187-O187_10


103 / 4e-27
O34-O034_11


100 / 7e-26
O65-O065_10


89 / 9e-22
O110-O110_03


86 / 9e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
WffZ
GT nameDonorAcceptorPosition | Link.NumSimilar to
WfgA

GT NameDonorAcceptorScore / e-value
O108-O108_14


392 / 2e-137
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuB

aLFucNAc(1->

->3)bDGlcNAc

GT NameDonorAcceptorScore / e-value
O15-WbuB


632 / 0.0
O145-WbuB

aLFucNAm(1->

->3)bDGlcNAc

629 / 0.0
O108-O108_18


605 / 0.0
O151-WbfG


598 / 0.0
O118-WbfG


598 / 0.0
O25-WbuB


556 / 0.0
O4-WbuB

aLFucNAc(1->

->3)bDGlcNAc

556 / 0.0
O177-WbuB


555 / 0.0
O172-WbuB

aLFucNAc(1->

->3)aDGlcNAc

544 / 0.0
O12-O012_09


514 / 0.0
O26-WbuB

aLFucNAc(1->

->3)bDGlcNAc

503 / 0.0
O98-WbwW

aLQuiNAc(1->

->3)bDGlcNAc

446 / 3e-158
O181-O181_07


378 / 6e-132
O123-WbwH


366 / 7e-127
O186-O186_16


329 / 1e-112
O163-O163_11


326 / 2e-111
NMR
1H-NMR4.93 3.58 3.57 3.45 3.76 3.76 3.86 5.09 3.69 3.89 4.09 4.32 3.65 3.89 4.64 3.42 3.52 3.51 3.49 4.02 4.09 4.98 4.45 4.06 4.22 4.50 1.31 4.49 3.87 3.69 3.65 3.47 3.76 3.94 3.85 3.90 3.98 3.64 3.97
Solvent: D2O
Temp: 30C
pD:
Ref: Acetone 2.225 ppm
Comment: 1H-NMR [2]
13C-NMR98.50 72.50 75.20 71.00 73.00 62.10 100.80 69.60 70.80 71.20 71.00 67.20 104.50 75.20 76.70 70.10 76.40 65.70 99.50 50.40 72.10 79.20 69.40 16.80 103.10 56.90 79.90 70.10 77.30 62.30 67.70 70.80 72.30
Solvent: D2O
Temp: 30C
pD:
Ref: Acetone 31.45 ppm
Comment: 13C-NMR [2]
Enzymes
FlippaseMSNKNKTFKDFINYFLGDLFVKGFMFISLPLLSRIMSPEDYGRMSLINAAVMILYVFISLNLQNAVINAY MKNEVDFPVYLGSVLWGLTAAQVLLVALSIYFAVPLGMLLSISKYDVYWVVAICILLSYIYIYTSYLQGA RLSSSFVKLNIFSKISEVVVIFVFAWFLTQDKYLAKVYAQLVISFILLTYVLKKLKKIAVFKFNVRYFIS ALAFSSPLIIHVLSNALLSQVDRLFIAKMLGEGQAGIYSFAYNIGMCILVVVMAWNSSWQPKLYKLIDSK DNGKIIRIVDVSSLLLLIVSFLSILFSKQMVEVLADNRYRESISVVPVILIGNSLIHIYLSYVNFTFYKK KTIYVSIGTLLAVAINIALNYILIPIYGIHGAAWATVIAYFMLAFFHYLIATIMLKANPLSLFLLLWYSA LLLASYFLVIYLDSLSLWISLSIKAMIIFIILIILMKTKIYNELKE
Trembl: B5L3I1
PolymeraseMTVSIYLLLLAFVFLLAMSDFFIIADARNRFLLYIILFSLLVTFIGLRYQTGLDWLFYNNLFNGEGFSLA IEPGYYFFSYVSSFLMGYWIYQALITAVLIICLKTFFEKNTKNYLFCIGFFFLYQFIFVTEAIRQIIALS IILVAYKKFYDGKKLQFHMLTILACSFHISAVIVFILIPFLKRRNIYILKILTIVGLVLAIFSVYPVDYL IQLLSLLPAGGYIEKIRWYSQDDYAGSVLTFSLVFKVFVVLLFDYRFKSIKSHGQSLINARAYDFIYTSV YLMIFMDVYLGRFGTISTRLDVYFIPCFLIALNHLINEHKQGVSRFIFFFVVMVYFTINYLSIMNGYYFE KFYSPYQNYITEFLNPGSYSDRGWDVRYYFSNKELLQ
Trembl: B5L3I2
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Perepelov, AV. "Structure of a teichoic acid-like O-polysaccharide of Escherichia coli O29". Carbohydrate Research. 341(12. (2006), pp 2176-80 PubMed: [16784735]