O-Antigen Description

Serogroup:O114
Serotype H:2
Serotype K:
Strain:
Structure:
->4)bDQui3NLSerAc(1->3)bDRibf(1->4)bDGal(1->3)aDGlcNAc(1->
Comment:- Structure [1]
- SerAc=N-Acetyl-Seryl
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuL

GT NameDonorAcceptorScore / e-value
O63-WbuL-like protein


86 / 5e-21
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuM

GT NameDonorAcceptorScore / e-value
O5-O05_12


189 / 2e-59
O55-WbgO


90 / 9e-23
O55-WbgO


90 / 9e-23
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuP

bDGal(1->

->3)aDGlcNAc

3 | 1
GT NameDonorAcceptorScore / e-value
O63-WbuP


317 / 1e-109
O64-O064_03


243 / 7e-81
O54-O054_06


239 / 5e-79
O92-O092_07


184 / 5e-58
O74-O074_09


154 / 4e-46
O160-O160_08


107 / 8e-29
O174-WbcZ


102 / 4e-27
O117-WbeD

bDGal(1->

->3)aDGalNAc

100 / 3e-26
O107-WclZ

bDGal(1->

->3)aDGalNAc

99 / 8e-26
O70-O070_13


99 / 4e-26
O171-O171_13


96 / 8e-25
O7-WbbD

bDGal(1->

->3)aDGlcNAc

95 / 1e-24
O155-WclG


93 / 6e-24
O55-WbgO


92 / 2e-23
O55-WbgO


92 / 2e-23
O178-O178_09


91 / 4e-23
O153-O153_06


91 / 4e-23
O104-WbwC

bDGal(1->

->3)bDGalNAc

89 / 2e-22
O112-WfeJ


88 / 3e-22
O185-O185_03


88 / 4e-22
O71-WdaK

bDGal(1->

->3)aDGalNAc

87 / 5e-22
O37-O037_13


87 / 6e-22
O65-O065_13


86 / 2e-21
O146-WbwW


84 / 5e-21
O167-WfdH


82 / 7e-20
O5-O05_15


81 / 1e-19
O23-O023_06


81 / 6e-20
O127-WbiP


81 / 7e-20
O90-O090_13


81 / 7e-20
NMR
1H-NMR5.31 5.26 4.60 4.53 2.09 2.05 1.39
Solvent: D2O
Temp: 70C
pD:
Ref: TSP 0.0 ppm
Comment: 1H-NMR [1]
13C-NMR110.62 74.94 74.72 81.92 62.70 98.04 105.60 105.30 54.00 57.95 58.95 20.70 176.36 174.00
Solvent: D2O
Temp: 70C
pD:
Ref: TSP 0.0 ppm
Comment: 13C-NMR [1]
Non-Sugar Components
- Acetate - Serine
Enzymes
FlippaseMKKLLTVTFFTGMLTFFKMISGFIISKIVAIYTGPSGIVLFGQIQSIVSALNGVINSPVG PGIVRFTAENHRKGLEHCYKWWIAGLSWVCIISAIIIPLSITLSSHIAFWTLGSEKYSWV IILTACLLPLTAIGTFISSVINGFQNYKVYVLLGIISAFLSLIIMIALIVFGKINGALLA ISVQNALIGGVMIIYASSQPWFNLRWLYGRVHKTYYKDIQRYIVMAITSAIVVPGSLIIV RNIIIHYVGWTEAGYWQAVWKISETYLAIITIALSTYYLPRLSSLSQKDDIIKEISSSLK IIIPLVMFFSMGIYLSRDFIISLLFTKEFLGARMLFQVQLIGDILKIASWLYAYVMISKG MTQLFVISEVLFSLLFISFSLVFIRCYGLIGVTYAYCLNYFIYLVFSVVVVKRAKYD
Trembl: Q697E1
PolymeraseMVTLFMEIILFISLSLFLILVYRVIANFSGVLALDFISFWFYTYIVFAFLGSLIIITGFG DDSYFVQPLSAHARNVFFGGSLMVLYAGLGTFSIFLLVLSLFLGKHRYKEKLIEKCTSES YDKITLAMLFIILMLVFFYYLISTFPSPLYLGLINASSEDIALRRIEVTKNLSNIANTYI ISIGMLMSYIVSYAYLALFSIHKKYPIRTFLSVLIASIFILSTGEKGPFLFYILGALICC SYAQGKIRRVSIKLIAITLFFLFLIYFIFVSSELSMITALIFDRIFIAQVISVYLSFDFY SNLGDIGFASLSNVFTKLYDSKSVMPASEELMSVYYPEMLKLGGWNVNGLFISEAWANFG VLGAIISPVIVGIENGILLSILMKIKKSPMQCAFYAYFTVKCVYFLTSFNAYLYHSDWIV CLLVLVLICFLNAIGKHFILKYK
Trembl: Q697D9
Literature
  • First Author: Dmitriev, BA. "Cell-wall lipopolysaccharide of Escherichia coli 0114:H2. Structure of the polysaccharide chain". European Journal of Biochemistry. 134(3). (1983), pp 517-521 PubMed: [6309515]
  • First Author: Feng, L. "Identification of Escherichia coli O114 O-antigen gene cluster and development of an O114 serogroup-specific PCR assay". Journal of Clinical Microbiology. 42(8). (2004), pp 3799-3804 PubMed: [15297533]
  • First Author: Zhou D. "Biochemical characterization of a new β-1,3-galactosyltransferase WbuP from Escherichia coli O114 that catalyzes the second step in O-antigen repeating-unit". Carbohydrate Research. (2013),