O-Antigen Description

Serogroup:O149
Serotype H:
Serotype K:
Strain:
Structure:
->3)bDGlcNAc4,6(S)Pyr(1->3)bLRha(1->4)bDGlcNAc(1->
Comment:- Structure [2]
- 4,6(S)Pyr=(S)-4,6-pyruvic acid acetal
GTs
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuU

GT NameDonorAcceptorScore / e-value
O55-WbgP


92 / 1e-23
O55-WbgP


92 / 8e-24
O169-O169_03


84 / 2e-20
O183-wbaS


82 / 4e-20
GT nameDonorAcceptorPosition | Link.NumSimilar to
WbuV

bLRha(1->

->4)bDGlcNAc

2 | 1
GT NameDonorAcceptorScore / e-value
O180-wfcU

bLRha(1->

->4)aDGlcNAc

392 / 4e-137
O2-wegR


363 / 1e-125
O50-O050_13


359 / 2e-124
NMR
1H-NMR4.82 4.82 4.75 2.02 2.02 1.30 1.30 1.50
Solvent: D2O
Temp: 85C
pD:
Ref: TSP 0 ppm
Comment: 1H-NMR [2]
partial data
13C-NMR103.20 102.20 101.30 56.80 55.60 23.30 23.20 17.50 101.30 25.40
Solvent: D2O
Temp: 70C
pD:
Ref: Dioxane 67.4 ppm
Comment: 13C-NMR [2]
partial data
Non-Sugar Components
- Pyruvic acid
Enzymes
FlippaseMNSNKRQTLFFSLDQIIDSGLVFIFIAIGGNLLDKSDMANVVLFQSVALVSVLFCSCFTTQYLLLRYKKQ SSLFWLKLFLFFCIITMLIVSLWFQSAEILFLFFVGISSEYIKRYCFYINNSCLSFFSTIITAFIFFVFI LMCWLNFMRINSTIYIYIYSGAKLIPLTIICCFLFIKTKFNSDGEYEMPSLWYAITDSLRFGGVFSVITI IYWITNQGFFIFFHDRMPAAELVEIRVTQNVFGVVTMLIALYDSMFLKKNIENKNKIFDWRSYFKFLVIS IVLITFNFILLYILSITIYKHLDVFKYSICLALAQFFYLSARMPVLILKLRYSLSIILWLYVCSLFLSSC YLFLKHNDYDFQYIVQSITLSNFFIFLFSLLIVFYKERIYGKNY
Trembl: Q45XG7
PolymeraseMLVTILALFLFIQLLYLISYKRNFNTKSINDILSFIIFLFLIVLFFFRNEDFGADTQNYLNEFDEYCSNP SGYIGVDYTYKYIFDLINFLMLDSCHISWLIWIWPIFVIGCIFSAITIFRVDKIYIIALFSSFIGIELLT NALRQGFSIAVLLLSFCLFIKRRYFLFLIAVTISFLFHQASILIVSIFIISRCSIRIVVPSIVVGVFLLF ATNILDVVPWVIEFKKLIYKYLPYADEDFIIRIISIINTLCLCVLYLIVMIKSHCKDKIINNIVINATFV CCIASIVPYLGFRIIYGVYPLLLLLTYCSIRNYIGRVSSYNYLSLSICINIFISIMWLCGSSHMNKIPFV SIII
Trembl: Q45XG5
Literature
  • First Author: Liu, B. "Structure and genetics of Shigella O antigens". FEMS Microbiology. 32(4). (2008), pp 627-653 PubMed: [18422615]
  • First Author: Adeyeye, A. "Structural studies of the Escherichia coli O-149 O-antigen polysaccharide". Carbohydrate Research. 176(2). (1988), pp 231-236 PubMed: [3046745]
  • First Author: Han, W. "DNA microarray-based identification of serogroups and virulence gene patterns of Escherichia coli isolates associated with porcine postweaning diarrhea and edema disease". Applied and Environmental Microbiology. 73(12). (2007), pp 4082-4088 PubMed: [17449692]